Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3NX33

Protein Details
Accession A0A0C3NX33    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-21SPQPPPRHTARKSRRSSVKTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 8, cyto 4, pero 2
Family & Domain DBs
Amino Acid Sequences MSPQPPPRHTARKSRRSSVKTLVTSLALLLQTFLQNASTPLHLWPLSFAHSTFVFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.76
4 0.77
5 0.75
6 0.73
7 0.64
8 0.59
9 0.5
10 0.4
11 0.35
12 0.28
13 0.2
14 0.11
15 0.09
16 0.07
17 0.06
18 0.06
19 0.06
20 0.06
21 0.05
22 0.05
23 0.07
24 0.08
25 0.08
26 0.09
27 0.1
28 0.14
29 0.13
30 0.13
31 0.14
32 0.15
33 0.18
34 0.18
35 0.18
36 0.18