Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3JBL9

Protein Details
Accession A0A0C3JBL9   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-31VRDRLIRRFTNPWRRLRKKHGCGTSCRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MDRTVRDRLIRRFTNPWRRLRKKHGCGTSCRLDDVRGSLQGPLSSDNITTELYSESPTRHLTFPRFSTYDGMDGPPQRHPPLCRRLFDRWNVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.74
3 0.75
4 0.77
5 0.82
6 0.85
7 0.86
8 0.87
9 0.85
10 0.87
11 0.87
12 0.8
13 0.78
14 0.76
15 0.74
16 0.63
17 0.55
18 0.46
19 0.37
20 0.33
21 0.3
22 0.25
23 0.18
24 0.17
25 0.16
26 0.16
27 0.15
28 0.15
29 0.12
30 0.11
31 0.1
32 0.09
33 0.09
34 0.09
35 0.09
36 0.08
37 0.07
38 0.07
39 0.07
40 0.09
41 0.09
42 0.08
43 0.11
44 0.13
45 0.15
46 0.16
47 0.2
48 0.23
49 0.27
50 0.3
51 0.33
52 0.32
53 0.31
54 0.32
55 0.3
56 0.29
57 0.24
58 0.24
59 0.22
60 0.24
61 0.24
62 0.27
63 0.3
64 0.3
65 0.35
66 0.38
67 0.43
68 0.51
69 0.56
70 0.56
71 0.58
72 0.65
73 0.68