FuNGI

E9E5M6

Protein Details

Accession

E9E5M6

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
470-500	AEAAMKKDKDEDKRKKDKKDRHHRHAGEVAG	Basic

NLS Segment(s)

Position	Sequence
476-494	KDKDEDKRKKDKKDRHHRH

Subcellular Location(s)

nucl 13, cyto_nucl 12.333, cyto 10.5, mito_nucl 7.333

Family & Domain DBs

InterPro	View protein in InterPro IPR001623 DnaJ_domain IPR018253 DnaJ_domain_CS IPR026894 DnaJ_X IPR036869 J_dom_sf
KEGG	maw:MAC_05174 -
Pfam	View protein in Pfam PF00226 DnaJ PF14308 DnaJ-X
PROSITE	View protein in PROSITE PS00636 DNAJ_1 PS50076 DNAJ_2
CDD	cd06257 DnaJ

Amino Acid Sequences

MVVDTAYYDTLGVQPTATELQIKKAYRKLAIVHHPDKNPNDPAAHEKFQEIGEAYQVLSDTELRKAYDKFGKDHAKPQEGFTDPAEFFTSIFGGEAFEDWIGEISLMKDLTATMDIAMAEGEDQSETPANVEFPGTEEAKRQSAQEFAEKEAAAAAAGAHGAPSAPPPPTVVVEEEKPSGTAHPATAAGPTPPPRSDATSPAPSSSSRNRTQIPLRPALSDRPHDEASIQAAEEELRQKEKKKGGLTKEQREQLAAYEKERAAIRQKRVDTLAEKLLDRLSVWTETDKGDDVTRAFQEKMRLEVENLKMESFGIDILHAIGQTYVSKASGLLRSQKFLGIGGFFSRLKDKGTLVKDTWNTISSALDAQQTVEDMAKMEAKGGEDWTEEKRVEYERRVTGKILTAAWRGSKFEIQSVLREVCDSVLYNKKVPLSKRLERAQALVLIGDIFLKAQRSPEEEGDYLVFEQLVAEAAMKKDKDEDKRKKDKKDRHHRHAGEVAGDAPNVPKA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.09
2	0.12
3	0.14
4	0.14
5	0.18
6	0.17
7	0.24
8	0.32
9	0.35
10	0.39
11	0.43
12	0.49
13	0.47
14	0.51
15	0.49
16	0.51
17	0.58
18	0.62
19	0.64
20	0.65
21	0.67
22	0.69
23	0.69
24	0.66
25	0.61
26	0.54
27	0.48
28	0.43
29	0.46
30	0.46
31	0.45
32	0.39
33	0.35
34	0.33
35	0.31
36	0.32
37	0.25
38	0.18
39	0.16
40	0.16
41	0.15
42	0.14
43	0.13
44	0.1
45	0.1
46	0.12
47	0.12
48	0.15
49	0.17
50	0.17
51	0.21
52	0.22
53	0.29
54	0.33
55	0.35
56	0.35
57	0.43
58	0.51
59	0.5
60	0.58
61	0.59
62	0.6
63	0.58
64	0.57
65	0.55
66	0.48
67	0.48
68	0.41
69	0.38
70	0.3
71	0.3
72	0.3
73	0.22
74	0.19
75	0.18
76	0.17
77	0.1
78	0.1
79	0.08
80	0.06
81	0.06
82	0.07
83	0.07
84	0.06
85	0.06
86	0.06
87	0.06
88	0.06
89	0.06
90	0.06
91	0.05
92	0.08
93	0.08
94	0.07
95	0.07
96	0.07
97	0.08
98	0.09
99	0.08
100	0.06
101	0.07
102	0.07
103	0.07
104	0.07
105	0.06
106	0.05
107	0.05
108	0.05
109	0.04
110	0.04
111	0.05
112	0.07
113	0.07
114	0.07
115	0.08
116	0.08
117	0.08
118	0.08
119	0.07
120	0.09
121	0.12
122	0.13
123	0.13
124	0.16
125	0.18
126	0.21
127	0.22
128	0.2
129	0.18
130	0.21
131	0.22
132	0.26
133	0.25
134	0.24
135	0.28
136	0.26
137	0.25
138	0.21
139	0.19
140	0.12
141	0.1
142	0.07
143	0.04
144	0.04
145	0.04
146	0.03
147	0.03
148	0.03
149	0.03
150	0.05
151	0.06
152	0.07
153	0.08
154	0.09
155	0.11
156	0.12
157	0.14
158	0.15
159	0.16
160	0.17
161	0.19
162	0.19
163	0.17
164	0.16
165	0.15
166	0.13
167	0.12
168	0.12
169	0.1
170	0.1
171	0.11
172	0.1
173	0.11
174	0.11
175	0.09
176	0.11
177	0.15
178	0.16
179	0.16
180	0.18
181	0.19
182	0.24
183	0.25
184	0.28
185	0.31
186	0.34
187	0.34
188	0.33
189	0.32
190	0.28
191	0.3
192	0.32
193	0.33
194	0.31
195	0.35
196	0.35
197	0.39
198	0.45
199	0.48
200	0.46
201	0.45
202	0.43
203	0.41
204	0.41
205	0.42
206	0.4
207	0.36
208	0.32
209	0.31
210	0.3
211	0.28
212	0.26
213	0.21
214	0.19
215	0.16
216	0.13
217	0.08
218	0.07
219	0.07
220	0.08
221	0.1
222	0.09
223	0.13
224	0.14
225	0.18
226	0.25
227	0.29
228	0.34
229	0.39
230	0.46
231	0.48
232	0.57
233	0.63
234	0.64
235	0.65
236	0.63
237	0.55
238	0.48
239	0.42
240	0.34
241	0.33
242	0.26
243	0.21
244	0.22
245	0.21
246	0.23
247	0.23
248	0.22
249	0.23
250	0.29
251	0.33
252	0.36
253	0.37
254	0.37
255	0.39
256	0.4
257	0.33
258	0.29
259	0.29
260	0.23
261	0.22
262	0.21
263	0.19
264	0.16
265	0.15
266	0.12
267	0.09
268	0.08
269	0.09
270	0.09
271	0.1
272	0.1
273	0.11
274	0.11
275	0.1
276	0.09
277	0.1
278	0.1
279	0.11
280	0.12
281	0.13
282	0.13
283	0.15
284	0.2
285	0.2
286	0.23
287	0.22
288	0.22
289	0.21
290	0.27
291	0.28
292	0.27
293	0.26
294	0.23
295	0.21
296	0.2
297	0.19
298	0.12
299	0.1
300	0.05
301	0.04
302	0.04
303	0.05
304	0.05
305	0.05
306	0.05
307	0.04
308	0.05
309	0.05
310	0.06
311	0.05
312	0.05
313	0.06
314	0.06
315	0.09
316	0.13
317	0.14
318	0.23
319	0.23
320	0.25
321	0.26
322	0.26
323	0.24
324	0.2
325	0.2
326	0.11
327	0.11
328	0.11
329	0.13
330	0.12
331	0.13
332	0.15
333	0.14
334	0.16
335	0.17
336	0.18
337	0.23
338	0.26
339	0.3
340	0.29
341	0.35
342	0.34
343	0.35
344	0.35
345	0.28
346	0.25
347	0.21
348	0.2
349	0.14
350	0.13
351	0.12
352	0.11
353	0.1
354	0.1
355	0.1
356	0.1
357	0.09
358	0.08
359	0.07
360	0.07
361	0.08
362	0.1
363	0.09
364	0.1
365	0.11
366	0.12
367	0.13
368	0.13
369	0.13
370	0.12
371	0.14
372	0.16
373	0.19
374	0.17
375	0.17
376	0.19
377	0.23
378	0.28
379	0.31
380	0.36
381	0.4
382	0.45
383	0.46
384	0.45
385	0.41
386	0.41
387	0.39
388	0.34
389	0.3
390	0.27
391	0.28
392	0.31
393	0.29
394	0.26
395	0.26
396	0.28
397	0.25
398	0.26
399	0.3
400	0.27
401	0.29
402	0.32
403	0.3
404	0.26
405	0.26
406	0.23
407	0.17
408	0.17
409	0.15
410	0.16
411	0.24
412	0.26
413	0.28
414	0.3
415	0.35
416	0.39
417	0.41
418	0.45
419	0.46
420	0.51
421	0.58
422	0.62
423	0.64
424	0.61
425	0.61
426	0.54
427	0.48
428	0.4
429	0.31
430	0.25
431	0.17
432	0.15
433	0.12
434	0.08
435	0.05
436	0.06
437	0.08
438	0.08
439	0.12
440	0.16
441	0.2
442	0.25
443	0.28
444	0.33
445	0.32
446	0.33
447	0.3
448	0.29
449	0.25
450	0.2
451	0.16
452	0.09
453	0.09
454	0.07
455	0.07
456	0.06
457	0.07
458	0.09
459	0.1
460	0.16
461	0.16
462	0.17
463	0.24
464	0.31
465	0.41
466	0.5
467	0.6
468	0.65
469	0.77
470	0.85
471	0.89
472	0.92
473	0.92
474	0.92
475	0.92
476	0.93
477	0.92
478	0.94
479	0.87
480	0.85
481	0.82
482	0.74
483	0.65
484	0.55
485	0.47
486	0.37
487	0.33
488	0.24

E9E5M6

3D AlphaFold-predicted Structure Viewer