Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DXE5

Protein Details
Accession E9DXE5   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
171-191GACLKRCKRAVGKFTSRCRDAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036305  RGS_sf  
IPR044926  RGS_subdomain_2  
KEGG maw:MAC_02293  -  
Amino Acid Sequences METELPTLGDILLNTASPPWTLHAFTAHLNRHCCLEALQFILDTQHYAACYEGLVRINSASSSSSNSVAKLWQNLIKLYILPTGQRQLNIAEKEREHLLHLPPEPPPSPSELHEACRCAYDLLNDSLTAFFRTSEPMQDSEETRSPPDQQPQLQAAATDEHQDGWLCHLFGACLKRCKRAVGKFTSRCRDACLPLLGTVPWQVTLGHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.09
5 0.1
6 0.11
7 0.13
8 0.15
9 0.15
10 0.17
11 0.19
12 0.22
13 0.3
14 0.34
15 0.36
16 0.38
17 0.37
18 0.37
19 0.36
20 0.33
21 0.26
22 0.24
23 0.21
24 0.2
25 0.2
26 0.17
27 0.17
28 0.17
29 0.15
30 0.12
31 0.1
32 0.08
33 0.08
34 0.09
35 0.09
36 0.08
37 0.08
38 0.07
39 0.1
40 0.11
41 0.11
42 0.11
43 0.11
44 0.11
45 0.11
46 0.11
47 0.1
48 0.08
49 0.12
50 0.13
51 0.15
52 0.15
53 0.16
54 0.15
55 0.17
56 0.18
57 0.16
58 0.17
59 0.18
60 0.19
61 0.19
62 0.2
63 0.17
64 0.16
65 0.15
66 0.15
67 0.12
68 0.11
69 0.13
70 0.16
71 0.16
72 0.16
73 0.16
74 0.16
75 0.21
76 0.23
77 0.24
78 0.23
79 0.22
80 0.23
81 0.24
82 0.22
83 0.18
84 0.18
85 0.17
86 0.19
87 0.2
88 0.19
89 0.19
90 0.21
91 0.2
92 0.18
93 0.17
94 0.15
95 0.16
96 0.16
97 0.21
98 0.19
99 0.22
100 0.23
101 0.24
102 0.21
103 0.21
104 0.19
105 0.14
106 0.13
107 0.12
108 0.13
109 0.13
110 0.13
111 0.12
112 0.12
113 0.12
114 0.12
115 0.11
116 0.08
117 0.07
118 0.07
119 0.11
120 0.11
121 0.14
122 0.16
123 0.16
124 0.18
125 0.19
126 0.2
127 0.22
128 0.24
129 0.22
130 0.22
131 0.22
132 0.24
133 0.27
134 0.32
135 0.33
136 0.32
137 0.36
138 0.36
139 0.37
140 0.32
141 0.28
142 0.23
143 0.19
144 0.17
145 0.15
146 0.13
147 0.11
148 0.12
149 0.12
150 0.11
151 0.13
152 0.15
153 0.12
154 0.12
155 0.12
156 0.12
157 0.15
158 0.23
159 0.24
160 0.31
161 0.33
162 0.4
163 0.42
164 0.5
165 0.56
166 0.59
167 0.63
168 0.64
169 0.73
170 0.75
171 0.83
172 0.83
173 0.77
174 0.68
175 0.66
176 0.62
177 0.55
178 0.52
179 0.48
180 0.41
181 0.39
182 0.4
183 0.32
184 0.27
185 0.25
186 0.2
187 0.15
188 0.14