Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3KBK3

Protein Details
Accession A0A0C3KBK3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
7-28VPIPNLTKKSRGRRVPTVQTISHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences RTLPIPVPIPNLTKKSRGRRVPTVQTISNCARGQRDAGLSARIYLCDVSGCGKCFARGEHLKRHIRSIHTHEKPHRCPFPGCGKEFSRHDNLGQHMKVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.58
3 0.64
4 0.69
5 0.71
6 0.75
7 0.81
8 0.82
9 0.82
10 0.77
11 0.71
12 0.63
13 0.61
14 0.53
15 0.51
16 0.41
17 0.34
18 0.3
19 0.26
20 0.26
21 0.23
22 0.22
23 0.17
24 0.17
25 0.18
26 0.16
27 0.17
28 0.15
29 0.12
30 0.11
31 0.09
32 0.08
33 0.06
34 0.06
35 0.07
36 0.09
37 0.1
38 0.11
39 0.11
40 0.11
41 0.12
42 0.13
43 0.18
44 0.25
45 0.29
46 0.37
47 0.46
48 0.53
49 0.53
50 0.58
51 0.55
52 0.5
53 0.52
54 0.52
55 0.53
56 0.52
57 0.59
58 0.62
59 0.68
60 0.71
61 0.74
62 0.71
63 0.64
64 0.61
65 0.6
66 0.62
67 0.6
68 0.56
69 0.53
70 0.51
71 0.54
72 0.56
73 0.55
74 0.51
75 0.45
76 0.45
77 0.45
78 0.47
79 0.49