Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3K465

Protein Details
Accession A0A0C3K465    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-110SAKTPTKKAKCGRKQKQSNSPSSLKSPASRKKKKAKKSMSKTAIFDHydrophilic
NLS Segment(s)
PositionSequence
60-102SPKKISAKTPTKKAKCGRKQKQSNSPSSLKSPASRKKKKAKKS
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
Amino Acid Sequences MDPPNEPDPIGCGVESVEQANEQKASPGSTIYTFTFIDNAYIPPCESVTSTPVASPVKNSPKKISAKTPTKKAKCGRKQKQSNSPSSLKSPASRKKKKAKKSMSKTAIFDISDSEDSIAEPPPQSITAHLHLETLSHTKGVVDMVTADSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.14
4 0.11
5 0.12
6 0.13
7 0.15
8 0.15
9 0.13
10 0.15
11 0.14
12 0.16
13 0.14
14 0.14
15 0.14
16 0.15
17 0.18
18 0.16
19 0.18
20 0.16
21 0.16
22 0.16
23 0.14
24 0.14
25 0.12
26 0.12
27 0.1
28 0.1
29 0.1
30 0.1
31 0.1
32 0.09
33 0.09
34 0.1
35 0.11
36 0.12
37 0.12
38 0.12
39 0.15
40 0.15
41 0.14
42 0.15
43 0.21
44 0.3
45 0.35
46 0.37
47 0.37
48 0.44
49 0.5
50 0.51
51 0.52
52 0.52
53 0.57
54 0.6
55 0.66
56 0.69
57 0.67
58 0.71
59 0.7
60 0.71
61 0.7
62 0.76
63 0.76
64 0.77
65 0.84
66 0.84
67 0.87
68 0.83
69 0.81
70 0.76
71 0.7
72 0.61
73 0.54
74 0.49
75 0.41
76 0.38
77 0.4
78 0.42
79 0.5
80 0.57
81 0.63
82 0.7
83 0.77
84 0.83
85 0.85
86 0.87
87 0.87
88 0.88
89 0.9
90 0.88
91 0.83
92 0.75
93 0.68
94 0.6
95 0.49
96 0.39
97 0.3
98 0.25
99 0.2
100 0.18
101 0.15
102 0.11
103 0.12
104 0.13
105 0.13
106 0.1
107 0.1
108 0.1
109 0.11
110 0.12
111 0.12
112 0.14
113 0.18
114 0.2
115 0.23
116 0.23
117 0.22
118 0.21
119 0.21
120 0.21
121 0.2
122 0.16
123 0.13
124 0.13
125 0.13
126 0.14
127 0.14
128 0.11
129 0.08
130 0.09