Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3JFL8

Protein Details
Accession A0A0C3JFL8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
90-124YQTASPVKPPPRKPAPRRPRPAAKRAEKPKEKELEBasic
195-216EESPSKKRKTTKSPQPSQPPVAHydrophilic
NLS Segment(s)
PositionSequence
97-121KPPPRKPAPRRPRPAAKRAEKPKEK
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR001876  Znf_RanBP2  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00641  zf-RanBP  
Amino Acid Sequences MTSPNGKTPATLAPPPPVTPKANGVQGPRLRTTGISTTPAIPSPLRQTWKGNDSPPQLPQPSRPTKAAGYMTELLKEIAPVKKPDVSNPYQTASPVKPPPRKPAPRRPRPAAKRAEKPKEKELELTAREIIEATVPKGSKRSRPPLELEDSPRVEEVSDEEFPTPAINGTSSQSPRFLSSSKSAGEVDEIVHLDEESPSKKRKTTKSPQPSQPPVAEVIDIDASELAPSSALVRPSEIIEPDELPKVNGKPNSPATTSTLPTANARSLFGIKSSAPKEPSKLRYSYQVDKVQVVASQTTSTPPPAPSLFTPLTPPLPPVSSLFTSPPTAPAPTTTQPVTCPPKAQLSPKDEALAMNVDDLPKYSFTVKETVYPAGPSFENARKVASEAPVSSLPTFDIRTVPANVINGFNWTAAGLKAPTPSIGSQWKCDLCQLQNPDSAKEKCTVCDAPRPGIAQSKPVSTCVMPPAPPAPPVKGFDWSAAGLAPPSKASGGSWTCSVCDLSNPATATDKCTVCDAPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.47
4 0.44
5 0.41
6 0.39
7 0.43
8 0.41
9 0.45
10 0.47
11 0.46
12 0.5
13 0.52
14 0.54
15 0.5
16 0.46
17 0.4
18 0.37
19 0.37
20 0.34
21 0.33
22 0.31
23 0.3
24 0.32
25 0.33
26 0.33
27 0.3
28 0.24
29 0.24
30 0.29
31 0.34
32 0.36
33 0.38
34 0.43
35 0.48
36 0.55
37 0.56
38 0.53
39 0.54
40 0.56
41 0.57
42 0.55
43 0.56
44 0.53
45 0.5
46 0.53
47 0.55
48 0.58
49 0.58
50 0.55
51 0.52
52 0.49
53 0.54
54 0.51
55 0.42
56 0.39
57 0.39
58 0.38
59 0.35
60 0.33
61 0.26
62 0.21
63 0.2
64 0.18
65 0.19
66 0.22
67 0.24
68 0.26
69 0.32
70 0.33
71 0.39
72 0.43
73 0.43
74 0.47
75 0.47
76 0.46
77 0.41
78 0.42
79 0.4
80 0.34
81 0.37
82 0.38
83 0.44
84 0.5
85 0.55
86 0.64
87 0.69
88 0.78
89 0.8
90 0.83
91 0.84
92 0.86
93 0.9
94 0.9
95 0.9
96 0.88
97 0.88
98 0.88
99 0.86
100 0.85
101 0.86
102 0.88
103 0.85
104 0.82
105 0.81
106 0.78
107 0.71
108 0.64
109 0.6
110 0.58
111 0.5
112 0.47
113 0.39
114 0.31
115 0.29
116 0.25
117 0.19
118 0.13
119 0.13
120 0.11
121 0.14
122 0.14
123 0.15
124 0.21
125 0.25
126 0.3
127 0.39
128 0.48
129 0.51
130 0.56
131 0.61
132 0.61
133 0.64
134 0.61
135 0.57
136 0.54
137 0.48
138 0.44
139 0.38
140 0.32
141 0.25
142 0.2
143 0.17
144 0.14
145 0.14
146 0.14
147 0.14
148 0.14
149 0.14
150 0.14
151 0.11
152 0.07
153 0.06
154 0.06
155 0.07
156 0.09
157 0.14
158 0.16
159 0.17
160 0.18
161 0.18
162 0.2
163 0.21
164 0.2
165 0.18
166 0.2
167 0.23
168 0.22
169 0.23
170 0.21
171 0.19
172 0.19
173 0.16
174 0.13
175 0.11
176 0.1
177 0.09
178 0.08
179 0.08
180 0.07
181 0.07
182 0.09
183 0.09
184 0.12
185 0.17
186 0.19
187 0.23
188 0.31
189 0.39
190 0.48
191 0.57
192 0.64
193 0.71
194 0.79
195 0.83
196 0.85
197 0.82
198 0.75
199 0.66
200 0.56
201 0.47
202 0.38
203 0.29
204 0.19
205 0.14
206 0.11
207 0.09
208 0.08
209 0.05
210 0.05
211 0.04
212 0.04
213 0.03
214 0.03
215 0.03
216 0.05
217 0.07
218 0.08
219 0.08
220 0.08
221 0.09
222 0.11
223 0.12
224 0.1
225 0.09
226 0.09
227 0.1
228 0.11
229 0.13
230 0.11
231 0.11
232 0.12
233 0.13
234 0.17
235 0.19
236 0.19
237 0.22
238 0.27
239 0.3
240 0.28
241 0.28
242 0.28
243 0.29
244 0.28
245 0.24
246 0.2
247 0.18
248 0.17
249 0.17
250 0.14
251 0.12
252 0.12
253 0.11
254 0.12
255 0.11
256 0.1
257 0.11
258 0.1
259 0.15
260 0.16
261 0.18
262 0.21
263 0.21
264 0.25
265 0.3
266 0.36
267 0.35
268 0.36
269 0.34
270 0.39
271 0.44
272 0.47
273 0.47
274 0.47
275 0.44
276 0.42
277 0.41
278 0.32
279 0.28
280 0.22
281 0.15
282 0.1
283 0.09
284 0.09
285 0.1
286 0.1
287 0.1
288 0.11
289 0.11
290 0.13
291 0.13
292 0.15
293 0.14
294 0.2
295 0.19
296 0.18
297 0.2
298 0.19
299 0.2
300 0.19
301 0.19
302 0.14
303 0.14
304 0.15
305 0.14
306 0.16
307 0.15
308 0.16
309 0.17
310 0.17
311 0.18
312 0.17
313 0.18
314 0.16
315 0.16
316 0.15
317 0.16
318 0.19
319 0.19
320 0.22
321 0.2
322 0.19
323 0.2
324 0.27
325 0.32
326 0.27
327 0.28
328 0.27
329 0.34
330 0.37
331 0.43
332 0.43
333 0.43
334 0.45
335 0.44
336 0.43
337 0.35
338 0.32
339 0.26
340 0.2
341 0.14
342 0.11
343 0.11
344 0.1
345 0.09
346 0.1
347 0.1
348 0.08
349 0.1
350 0.1
351 0.11
352 0.13
353 0.18
354 0.17
355 0.21
356 0.23
357 0.23
358 0.22
359 0.22
360 0.21
361 0.19
362 0.18
363 0.15
364 0.18
365 0.21
366 0.25
367 0.24
368 0.25
369 0.23
370 0.24
371 0.26
372 0.24
373 0.21
374 0.17
375 0.2
376 0.21
377 0.22
378 0.21
379 0.18
380 0.16
381 0.15
382 0.16
383 0.13
384 0.13
385 0.13
386 0.16
387 0.18
388 0.18
389 0.18
390 0.19
391 0.19
392 0.19
393 0.17
394 0.17
395 0.16
396 0.14
397 0.12
398 0.1
399 0.1
400 0.09
401 0.1
402 0.09
403 0.1
404 0.11
405 0.12
406 0.12
407 0.14
408 0.14
409 0.18
410 0.26
411 0.26
412 0.28
413 0.34
414 0.36
415 0.34
416 0.37
417 0.38
418 0.33
419 0.39
420 0.42
421 0.4
422 0.44
423 0.44
424 0.44
425 0.46
426 0.45
427 0.39
428 0.38
429 0.35
430 0.3
431 0.35
432 0.38
433 0.33
434 0.41
435 0.43
436 0.41
437 0.43
438 0.44
439 0.4
440 0.42
441 0.39
442 0.37
443 0.36
444 0.38
445 0.36
446 0.36
447 0.37
448 0.29
449 0.32
450 0.32
451 0.34
452 0.28
453 0.29
454 0.32
455 0.3
456 0.34
457 0.33
458 0.32
459 0.32
460 0.35
461 0.35
462 0.36
463 0.35
464 0.33
465 0.33
466 0.28
467 0.24
468 0.2
469 0.18
470 0.14
471 0.14
472 0.13
473 0.1
474 0.11
475 0.11
476 0.11
477 0.12
478 0.19
479 0.21
480 0.23
481 0.26
482 0.25
483 0.25
484 0.26
485 0.27
486 0.19
487 0.19
488 0.21
489 0.21
490 0.25
491 0.25
492 0.25
493 0.3
494 0.3
495 0.32
496 0.34
497 0.32
498 0.28
499 0.32