FuNGI

A0A0C3JFL8

Protein Details

Accession

A0A0C3JFL8

Localization Confidence

Medium

Confidence Score

14.2

NoLS Segment(s)

Position	Sequence	Protein Nature
90-124	YQTASPVKPPPRKPAPRRPRPAAKRAEKPKEKELE	Basic
195-216	EESPSKKRKTTKSPQPSQPPVA	Hydrophilic

NLS Segment(s)

Position	Sequence
97-121	KPPPRKPAPRRPRPAAKRAEKPKEK

Subcellular Location(s)

nucl 14.5, mito 10, cyto_nucl 10

Family & Domain DBs

InterPro	View protein in InterPro IPR001876 Znf_RanBP2
Gene Ontology	GO:0046872 F:metal ion binding
Pfam	View protein in Pfam PF00641 zf-RanBP

Amino Acid Sequences

MTSPNGKTPATLAPPPPVTPKANGVQGPRLRTTGISTTPAIPSPLRQTWKGNDSPPQLPQPSRPTKAAGYMTELLKEIAPVKKPDVSNPYQTASPVKPPPRKPAPRRPRPAAKRAEKPKEKELELTAREIIEATVPKGSKRSRPPLELEDSPRVEEVSDEEFPTPAINGTSSQSPRFLSSSKSAGEVDEIVHLDEESPSKKRKTTKSPQPSQPPVAEVIDIDASELAPSSALVRPSEIIEPDELPKVNGKPNSPATTSTLPTANARSLFGIKSSAPKEPSKLRYSYQVDKVQVVASQTTSTPPPAPSLFTPLTPPLPPVSSLFTSPPTAPAPTTTQPVTCPPKAQLSPKDEALAMNVDDLPKYSFTVKETVYPAGPSFENARKVASEAPVSSLPTFDIRTVPANVINGFNWTAAGLKAPTPSIGSQWKCDLCQLQNPDSAKEKCTVCDAPRPGIAQSKPVSTCVMPPAPPAPPVKGFDWSAAGLAPPSKASGGSWTCSVCDLSNPATATDKCTVCDAPR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.42
2	0.44
3	0.47
4	0.44
5	0.41
6	0.39
7	0.43
8	0.41
9	0.45
10	0.47
11	0.46
12	0.5
13	0.52
14	0.54
15	0.5
16	0.46
17	0.4
18	0.37
19	0.37
20	0.34
21	0.33
22	0.31
23	0.3
24	0.32
25	0.33
26	0.33
27	0.3
28	0.24
29	0.24
30	0.29
31	0.34
32	0.36
33	0.38
34	0.43
35	0.48
36	0.55
37	0.56
38	0.53
39	0.54
40	0.56
41	0.57
42	0.55
43	0.56
44	0.53
45	0.5
46	0.53
47	0.55
48	0.58
49	0.58
50	0.55
51	0.52
52	0.49
53	0.54
54	0.51
55	0.42
56	0.39
57	0.39
58	0.38
59	0.35
60	0.33
61	0.26
62	0.21
63	0.2
64	0.18
65	0.19
66	0.22
67	0.24
68	0.26
69	0.32
70	0.33
71	0.39
72	0.43
73	0.43
74	0.47
75	0.47
76	0.46
77	0.41
78	0.42
79	0.4
80	0.34
81	0.37
82	0.38
83	0.44
84	0.5
85	0.55
86	0.64
87	0.69
88	0.78
89	0.8
90	0.83
91	0.84
92	0.86
93	0.9
94	0.9
95	0.9
96	0.88
97	0.88
98	0.88
99	0.86
100	0.85
101	0.86
102	0.88
103	0.85
104	0.82
105	0.81
106	0.78
107	0.71
108	0.64
109	0.6
110	0.58
111	0.5
112	0.47
113	0.39
114	0.31
115	0.29
116	0.25
117	0.19
118	0.13
119	0.13
120	0.11
121	0.14
122	0.14
123	0.15
124	0.21
125	0.25
126	0.3
127	0.39
128	0.48
129	0.51
130	0.56
131	0.61
132	0.61
133	0.64
134	0.61
135	0.57
136	0.54
137	0.48
138	0.44
139	0.38
140	0.32
141	0.25
142	0.2
143	0.17
144	0.14
145	0.14
146	0.14
147	0.14
148	0.14
149	0.14
150	0.14
151	0.11
152	0.07
153	0.06
154	0.06
155	0.07
156	0.09
157	0.14
158	0.16
159	0.17
160	0.18
161	0.18
162	0.2
163	0.21
164	0.2
165	0.18
166	0.2
167	0.23
168	0.22
169	0.23
170	0.21
171	0.19
172	0.19
173	0.16
174	0.13
175	0.11
176	0.1
177	0.09
178	0.08
179	0.08
180	0.07
181	0.07
182	0.09
183	0.09
184	0.12
185	0.17
186	0.19
187	0.23
188	0.31
189	0.39
190	0.48
191	0.57
192	0.64
193	0.71
194	0.79
195	0.83
196	0.85
197	0.82
198	0.75
199	0.66
200	0.56
201	0.47
202	0.38
203	0.29
204	0.19
205	0.14
206	0.11
207	0.09
208	0.08
209	0.05
210	0.05
211	0.04
212	0.04
213	0.03
214	0.03
215	0.03
216	0.05
217	0.07
218	0.08
219	0.08
220	0.08
221	0.09
222	0.11
223	0.12
224	0.1
225	0.09
226	0.09
227	0.1
228	0.11
229	0.13
230	0.11
231	0.11
232	0.12
233	0.13
234	0.17
235	0.19
236	0.19
237	0.22
238	0.27
239	0.3
240	0.28
241	0.28
242	0.28
243	0.29
244	0.28
245	0.24
246	0.2
247	0.18
248	0.17
249	0.17
250	0.14
251	0.12
252	0.12
253	0.11
254	0.12
255	0.11
256	0.1
257	0.11
258	0.1
259	0.15
260	0.16
261	0.18
262	0.21
263	0.21
264	0.25
265	0.3
266	0.36
267	0.35
268	0.36
269	0.34
270	0.39
271	0.44
272	0.47
273	0.47
274	0.47
275	0.44
276	0.42
277	0.41
278	0.32
279	0.28
280	0.22
281	0.15
282	0.1
283	0.09
284	0.09
285	0.1
286	0.1
287	0.1
288	0.11
289	0.11
290	0.13
291	0.13
292	0.15
293	0.14
294	0.2
295	0.19
296	0.18
297	0.2
298	0.19
299	0.2
300	0.19
301	0.19
302	0.14
303	0.14
304	0.15
305	0.14
306	0.16
307	0.15
308	0.16
309	0.17
310	0.17
311	0.18
312	0.17
313	0.18
314	0.16
315	0.16
316	0.15
317	0.16
318	0.19
319	0.19
320	0.22
321	0.2
322	0.19
323	0.2
324	0.27
325	0.32
326	0.27
327	0.28
328	0.27
329	0.34
330	0.37
331	0.43
332	0.43
333	0.43
334	0.45
335	0.44
336	0.43
337	0.35
338	0.32
339	0.26
340	0.2
341	0.14
342	0.11
343	0.11
344	0.1
345	0.09
346	0.1
347	0.1
348	0.08
349	0.1
350	0.1
351	0.11
352	0.13
353	0.18
354	0.17
355	0.21
356	0.23
357	0.23
358	0.22
359	0.22
360	0.21
361	0.19
362	0.18
363	0.15
364	0.18
365	0.21
366	0.25
367	0.24
368	0.25
369	0.23
370	0.24
371	0.26
372	0.24
373	0.21
374	0.17
375	0.2
376	0.21
377	0.22
378	0.21
379	0.18
380	0.16
381	0.15
382	0.16
383	0.13
384	0.13
385	0.13
386	0.16
387	0.18
388	0.18
389	0.18
390	0.19
391	0.19
392	0.19
393	0.17
394	0.17
395	0.16
396	0.14
397	0.12
398	0.1
399	0.1
400	0.09
401	0.1
402	0.09
403	0.1
404	0.11
405	0.12
406	0.12
407	0.14
408	0.14
409	0.18
410	0.26
411	0.26
412	0.28
413	0.34
414	0.36
415	0.34
416	0.37
417	0.38
418	0.33
419	0.39
420	0.42
421	0.4
422	0.44
423	0.44
424	0.44
425	0.46
426	0.45
427	0.39
428	0.38
429	0.35
430	0.3
431	0.35
432	0.38
433	0.33
434	0.41
435	0.43
436	0.41
437	0.43
438	0.44
439	0.4
440	0.42
441	0.39
442	0.37
443	0.36
444	0.38
445	0.36
446	0.36
447	0.37
448	0.29
449	0.32
450	0.32
451	0.34
452	0.28
453	0.29
454	0.32
455	0.3
456	0.34
457	0.33
458	0.32
459	0.32
460	0.35
461	0.35
462	0.36
463	0.35
464	0.33
465	0.33
466	0.28
467	0.24
468	0.2
469	0.18
470	0.14
471	0.14
472	0.13
473	0.1
474	0.11
475	0.11
476	0.11
477	0.12
478	0.19
479	0.21
480	0.23
481	0.26
482	0.25
483	0.25
484	0.26
485	0.27
486	0.19
487	0.19
488	0.21
489	0.21
490	0.25
491	0.25
492	0.25
493	0.3
494	0.3
495	0.32
496	0.34
497	0.32
498	0.28
499	0.32

A0A0C3JFL8

3D AlphaFold-predicted Structure Viewer