Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3NQX9

Protein Details
Accession A0A0C3NQX9    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
40-67LDSRRNGECHRRARQRRRLRPVTNGSVIHydrophilic
NLS Segment(s)
PositionSequence
51-57RARQRRR
Subcellular Location(s) mito 11.5, mito_nucl 9.5, nucl 6.5, extr 4, cyto 2
Family & Domain DBs
Amino Acid Sequences MRNLASSTQFKLGVLASFIAGRDYRYRGPDMIGPRKKPCLDSRRNGECHRRARQRRRLRPVTNGSVIGGETHLRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.1
4 0.1
5 0.1
6 0.1
7 0.09
8 0.1
9 0.12
10 0.16
11 0.18
12 0.21
13 0.23
14 0.21
15 0.23
16 0.26
17 0.31
18 0.38
19 0.41
20 0.41
21 0.42
22 0.47
23 0.46
24 0.45
25 0.46
26 0.46
27 0.48
28 0.52
29 0.59
30 0.62
31 0.66
32 0.68
33 0.69
34 0.67
35 0.68
36 0.7
37 0.72
38 0.74
39 0.8
40 0.85
41 0.87
42 0.9
43 0.92
44 0.92
45 0.87
46 0.87
47 0.85
48 0.82
49 0.75
50 0.65
51 0.55
52 0.45
53 0.39
54 0.3
55 0.22