Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PBQ5

Protein Details
Accession A0A0C3PBQ5   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
170-196RNSAKESLFLRRKKREKNRDGTRKTFQHydrophilic
NLS Segment(s)
PositionSequence
168-192RRRNSAKESLFLRRKKREKNRDGTR
Subcellular Location(s) nucl 11.5, cyto_nucl 8.5, mito 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVGRAGIGWKVAVGCQDVFDRYSWRCLVEVLSEGRGREDVSTDTHRWGVVISAHPGGGSCWEGAGGLHGRGQRGTGRGEEEGEGGYGCLRFWSESSDSGQGSAIRNGREPKSKKDNIEILDSRRDHLMGVLTIRRLSGTGLSAKPTLPPKQGTTGCGHTHPTLEAVPRRRNSAKESLFLRRKKREKNRDGTRKTFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.15
4 0.16
5 0.17
6 0.17
7 0.2
8 0.19
9 0.24
10 0.23
11 0.23
12 0.22
13 0.21
14 0.22
15 0.19
16 0.22
17 0.19
18 0.22
19 0.22
20 0.21
21 0.22
22 0.2
23 0.18
24 0.15
25 0.15
26 0.12
27 0.16
28 0.22
29 0.22
30 0.24
31 0.24
32 0.23
33 0.21
34 0.19
35 0.16
36 0.14
37 0.15
38 0.15
39 0.15
40 0.15
41 0.15
42 0.14
43 0.13
44 0.11
45 0.09
46 0.07
47 0.06
48 0.06
49 0.06
50 0.06
51 0.09
52 0.08
53 0.07
54 0.1
55 0.12
56 0.12
57 0.12
58 0.14
59 0.13
60 0.14
61 0.15
62 0.14
63 0.15
64 0.15
65 0.16
66 0.16
67 0.14
68 0.12
69 0.1
70 0.08
71 0.06
72 0.06
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.05
79 0.09
80 0.1
81 0.11
82 0.14
83 0.15
84 0.15
85 0.15
86 0.15
87 0.13
88 0.13
89 0.15
90 0.15
91 0.13
92 0.16
93 0.19
94 0.22
95 0.29
96 0.31
97 0.36
98 0.44
99 0.48
100 0.48
101 0.52
102 0.54
103 0.47
104 0.52
105 0.47
106 0.4
107 0.43
108 0.4
109 0.35
110 0.3
111 0.27
112 0.19
113 0.17
114 0.16
115 0.09
116 0.12
117 0.13
118 0.13
119 0.13
120 0.13
121 0.12
122 0.1
123 0.1
124 0.09
125 0.1
126 0.14
127 0.15
128 0.17
129 0.18
130 0.18
131 0.21
132 0.25
133 0.28
134 0.27
135 0.3
136 0.31
137 0.39
138 0.41
139 0.4
140 0.39
141 0.41
142 0.38
143 0.37
144 0.37
145 0.29
146 0.29
147 0.26
148 0.23
149 0.19
150 0.23
151 0.29
152 0.33
153 0.41
154 0.42
155 0.49
156 0.51
157 0.53
158 0.54
159 0.57
160 0.54
161 0.52
162 0.55
163 0.58
164 0.63
165 0.67
166 0.7
167 0.7
168 0.75
169 0.8
170 0.86
171 0.86
172 0.88
173 0.92
174 0.93
175 0.94
176 0.93