Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3P093

Protein Details
Accession A0A0C3P093    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
44-69ILCCRCGGPRRRTGRRTYRHYNPYYGHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, extr 5, vacu 5, mito 3, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGSVCSAIGNGLNAIIAAIANLLMAIVGAFTMIIVTIVDVILDILCCRCGGPRRRTGRRTYRHYNPYYGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.03
5 0.03
6 0.03
7 0.02
8 0.02
9 0.02
10 0.02
11 0.02
12 0.02
13 0.02
14 0.02
15 0.02
16 0.02
17 0.02
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.03
31 0.03
32 0.04
33 0.04
34 0.04
35 0.08
36 0.17
37 0.27
38 0.35
39 0.45
40 0.55
41 0.65
42 0.72
43 0.78
44 0.81
45 0.81
46 0.82
47 0.82
48 0.82
49 0.82
50 0.81