Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PLL1

Protein Details
Accession A0A0C3PLL1    Localization Confidence High Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
26-60LFSSPKAPSRPKKAPEQPPGDRKRKRKVVLSDDDDHydrophilic
175-207LHPTRRTPPPPPPRPPPPKKSKKQVELEERIEEBasic
NLS Segment(s)
PositionSequence
31-52KAPSRPKKAPEQPPGDRKRKRK
178-197TRRTPPPPPPRPPPPKKSKK
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MPLDSSPLTEVIEIPTSDSGEDESGLFSSPKAPSRPKKAPEQPPGDRKRKRKVVLSDDDDLLPIVITSSPAPPAKTRRFGTTSVKATPATEKSANKHNSRSHTPSPPDRVPDFDPPKSVASPVRPPASGKPKATPMSELIRRVNSQPSSPFPKTSRPYSPLLKSSRTMLSRIAPLHPTRRTPPPPPPRPPPPKKSKKQVELEERIEEELAETIEGWSCMTEEERKELRRARLDAELGYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.15
4 0.15
5 0.15
6 0.13
7 0.1
8 0.11
9 0.09
10 0.09
11 0.09
12 0.1
13 0.1
14 0.08
15 0.12
16 0.15
17 0.2
18 0.26
19 0.35
20 0.43
21 0.53
22 0.63
23 0.63
24 0.71
25 0.75
26 0.8
27 0.8
28 0.81
29 0.8
30 0.81
31 0.86
32 0.85
33 0.84
34 0.82
35 0.83
36 0.84
37 0.81
38 0.8
39 0.8
40 0.8
41 0.81
42 0.78
43 0.71
44 0.62
45 0.55
46 0.46
47 0.36
48 0.25
49 0.15
50 0.09
51 0.06
52 0.04
53 0.05
54 0.06
55 0.07
56 0.1
57 0.12
58 0.14
59 0.17
60 0.26
61 0.32
62 0.4
63 0.41
64 0.43
65 0.46
66 0.49
67 0.53
68 0.52
69 0.5
70 0.44
71 0.44
72 0.38
73 0.35
74 0.35
75 0.29
76 0.25
77 0.26
78 0.26
79 0.27
80 0.36
81 0.41
82 0.4
83 0.45
84 0.45
85 0.46
86 0.51
87 0.56
88 0.52
89 0.53
90 0.55
91 0.55
92 0.57
93 0.53
94 0.51
95 0.44
96 0.42
97 0.38
98 0.43
99 0.42
100 0.35
101 0.35
102 0.32
103 0.33
104 0.29
105 0.27
106 0.2
107 0.18
108 0.23
109 0.25
110 0.25
111 0.24
112 0.25
113 0.31
114 0.37
115 0.39
116 0.36
117 0.35
118 0.39
119 0.42
120 0.41
121 0.36
122 0.3
123 0.31
124 0.33
125 0.34
126 0.3
127 0.29
128 0.3
129 0.29
130 0.33
131 0.27
132 0.25
133 0.25
134 0.28
135 0.34
136 0.35
137 0.37
138 0.33
139 0.41
140 0.43
141 0.46
142 0.48
143 0.43
144 0.47
145 0.49
146 0.52
147 0.5
148 0.51
149 0.47
150 0.41
151 0.41
152 0.43
153 0.38
154 0.34
155 0.29
156 0.28
157 0.3
158 0.3
159 0.29
160 0.27
161 0.29
162 0.36
163 0.36
164 0.38
165 0.38
166 0.46
167 0.5
168 0.52
169 0.59
170 0.62
171 0.68
172 0.72
173 0.76
174 0.77
175 0.82
176 0.85
177 0.85
178 0.85
179 0.86
180 0.88
181 0.9
182 0.9
183 0.89
184 0.89
185 0.89
186 0.88
187 0.86
188 0.81
189 0.74
190 0.64
191 0.55
192 0.45
193 0.35
194 0.25
195 0.17
196 0.13
197 0.09
198 0.08
199 0.07
200 0.08
201 0.08
202 0.08
203 0.07
204 0.07
205 0.07
206 0.1
207 0.15
208 0.16
209 0.24
210 0.31
211 0.34
212 0.42
213 0.49
214 0.55
215 0.58
216 0.59
217 0.56
218 0.56
219 0.56