Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3NXY7

Protein Details
Accession A0A0C3NXY7    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
37-61EEEVMKAKAKERKRRKVAGQAQQEEHydrophilic
NLS Segment(s)
PositionSequence
42-53KAKAKERKRRKV
97-98RA
100-107EEKEAKRK
Subcellular Location(s) nucl 13, cyto 9, pero 4
Family & Domain DBs
Amino Acid Sequences MSKSRPIIVTDNDNEGRVIIDWTQLPDDDIRYDTNDEEEVMKAKAKERKRRKVAGQAQQEEQARLEAERAAREKAEAKRTAQEAEEQRACKEEERRRAEEEKEAKRKCKAEAGKSSEAGAGGNETGKVRKVVMDPSCTCCAWANIVCEFIVDGNKKCIACKRKAEARPSNQKWVRMSVRPTEVLDLDELEAGGSGMKEAGTARYSGLENKLDLFELHETVVENLGCIFDMLELIPDESYGFGMAVSPSDSGLSELNSDELREEAEWLKNHSEDEEEESEGEDESMAEAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.31
3 0.27
4 0.19
5 0.18
6 0.11
7 0.13
8 0.13
9 0.16
10 0.17
11 0.16
12 0.17
13 0.17
14 0.18
15 0.17
16 0.17
17 0.16
18 0.18
19 0.19
20 0.18
21 0.19
22 0.17
23 0.16
24 0.16
25 0.16
26 0.15
27 0.14
28 0.17
29 0.16
30 0.22
31 0.29
32 0.37
33 0.47
34 0.57
35 0.67
36 0.73
37 0.81
38 0.84
39 0.87
40 0.88
41 0.86
42 0.86
43 0.79
44 0.72
45 0.69
46 0.62
47 0.51
48 0.41
49 0.33
50 0.23
51 0.18
52 0.17
53 0.14
54 0.13
55 0.17
56 0.19
57 0.19
58 0.19
59 0.2
60 0.26
61 0.3
62 0.37
63 0.35
64 0.36
65 0.4
66 0.42
67 0.42
68 0.36
69 0.36
70 0.32
71 0.36
72 0.38
73 0.33
74 0.32
75 0.32
76 0.33
77 0.3
78 0.35
79 0.36
80 0.41
81 0.48
82 0.51
83 0.54
84 0.58
85 0.55
86 0.55
87 0.56
88 0.56
89 0.59
90 0.59
91 0.58
92 0.6
93 0.6
94 0.53
95 0.53
96 0.51
97 0.5
98 0.56
99 0.6
100 0.57
101 0.55
102 0.54
103 0.44
104 0.37
105 0.28
106 0.18
107 0.1
108 0.06
109 0.06
110 0.06
111 0.06
112 0.06
113 0.07
114 0.08
115 0.07
116 0.1
117 0.11
118 0.17
119 0.2
120 0.25
121 0.26
122 0.3
123 0.32
124 0.3
125 0.29
126 0.23
127 0.2
128 0.17
129 0.18
130 0.15
131 0.13
132 0.14
133 0.13
134 0.12
135 0.12
136 0.09
137 0.1
138 0.1
139 0.1
140 0.12
141 0.14
142 0.15
143 0.16
144 0.23
145 0.25
146 0.31
147 0.38
148 0.43
149 0.5
150 0.56
151 0.65
152 0.67
153 0.7
154 0.75
155 0.71
156 0.75
157 0.68
158 0.67
159 0.59
160 0.57
161 0.52
162 0.46
163 0.46
164 0.41
165 0.42
166 0.39
167 0.38
168 0.32
169 0.27
170 0.23
171 0.19
172 0.14
173 0.11
174 0.09
175 0.08
176 0.06
177 0.05
178 0.04
179 0.04
180 0.03
181 0.03
182 0.03
183 0.03
184 0.04
185 0.04
186 0.06
187 0.07
188 0.07
189 0.08
190 0.1
191 0.11
192 0.13
193 0.16
194 0.16
195 0.16
196 0.17
197 0.17
198 0.15
199 0.15
200 0.15
201 0.13
202 0.12
203 0.12
204 0.11
205 0.11
206 0.11
207 0.14
208 0.1
209 0.09
210 0.08
211 0.08
212 0.07
213 0.07
214 0.06
215 0.04
216 0.04
217 0.04
218 0.06
219 0.06
220 0.07
221 0.06
222 0.06
223 0.07
224 0.06
225 0.07
226 0.05
227 0.05
228 0.04
229 0.05
230 0.05
231 0.06
232 0.07
233 0.07
234 0.07
235 0.07
236 0.08
237 0.08
238 0.09
239 0.09
240 0.09
241 0.09
242 0.11
243 0.11
244 0.11
245 0.1
246 0.1
247 0.1
248 0.1
249 0.12
250 0.14
251 0.19
252 0.21
253 0.24
254 0.28
255 0.27
256 0.28
257 0.26
258 0.26
259 0.22
260 0.27
261 0.25
262 0.23
263 0.22
264 0.23
265 0.22
266 0.19
267 0.17
268 0.1
269 0.08