Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3PGM7

Protein Details
Accession A0A0C3PGM7    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
23-43SVYGPKKKEKGKTTPKATMKTHydrophilic
NLS Segment(s)
PositionSequence
28-34KKKEKGK
Subcellular Location(s) nucl 13.5, cyto_nucl 11.333, mito_nucl 10.166, cyto 7, mito 5.5
Family & Domain DBs
Amino Acid Sequences MSLLSQSPTPDAEKLHSFMILLSVYGPKKKEKGKTTPKATMKTKELTFAVNDTNYLNFLQHVLDKHGLGQYRVSSSKHFPFKFVLPKAQSQAISNVIDVDNEVDYKDMVKRICSIHPGPMKIYVKMKYVEKLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.22
4 0.19
5 0.17
6 0.18
7 0.14
8 0.1
9 0.09
10 0.13
11 0.15
12 0.18
13 0.2
14 0.22
15 0.28
16 0.35
17 0.44
18 0.47
19 0.57
20 0.65
21 0.73
22 0.77
23 0.8
24 0.8
25 0.79
26 0.76
27 0.72
28 0.66
29 0.62
30 0.54
31 0.48
32 0.42
33 0.35
34 0.3
35 0.24
36 0.21
37 0.15
38 0.15
39 0.12
40 0.11
41 0.11
42 0.1
43 0.08
44 0.06
45 0.07
46 0.07
47 0.08
48 0.09
49 0.11
50 0.12
51 0.11
52 0.12
53 0.14
54 0.14
55 0.12
56 0.13
57 0.11
58 0.13
59 0.15
60 0.15
61 0.15
62 0.19
63 0.26
64 0.33
65 0.33
66 0.32
67 0.33
68 0.37
69 0.44
70 0.42
71 0.43
72 0.37
73 0.4
74 0.41
75 0.41
76 0.36
77 0.29
78 0.29
79 0.25
80 0.23
81 0.2
82 0.19
83 0.15
84 0.14
85 0.13
86 0.11
87 0.08
88 0.07
89 0.07
90 0.06
91 0.06
92 0.08
93 0.1
94 0.13
95 0.13
96 0.15
97 0.18
98 0.21
99 0.25
100 0.3
101 0.3
102 0.36
103 0.41
104 0.42
105 0.41
106 0.47
107 0.46
108 0.44
109 0.48
110 0.43
111 0.41
112 0.43
113 0.45