Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3JRM6

Protein Details
Accession A0A0C3JRM6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-39VPRIPYFLPPPPKKKKKNIRHPDLNLIQHydrophilic
NLS Segment(s)
PositionSequence
22-30PPKKKKKNI
Subcellular Location(s) mito 20, nucl 5.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MICGLNRKGLCVPRIPYFLPPPPKKKKKNIRHPDLNLIQIYHARLARAMINTGVMHSLCHGDQATLLERPVIMVLLLHPRPTTWHSRILATTTPKATLATFPSSRVHQLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.43
4 0.44
5 0.49
6 0.52
7 0.57
8 0.6
9 0.67
10 0.76
11 0.8
12 0.84
13 0.87
14 0.87
15 0.91
16 0.92
17 0.91
18 0.91
19 0.87
20 0.86
21 0.79
22 0.71
23 0.61
24 0.5
25 0.4
26 0.3
27 0.26
28 0.19
29 0.16
30 0.12
31 0.11
32 0.12
33 0.14
34 0.13
35 0.12
36 0.1
37 0.1
38 0.1
39 0.1
40 0.1
41 0.07
42 0.06
43 0.06
44 0.07
45 0.05
46 0.07
47 0.07
48 0.06
49 0.06
50 0.08
51 0.1
52 0.09
53 0.09
54 0.08
55 0.08
56 0.08
57 0.08
58 0.06
59 0.04
60 0.03
61 0.05
62 0.12
63 0.13
64 0.14
65 0.13
66 0.13
67 0.17
68 0.21
69 0.28
70 0.24
71 0.32
72 0.33
73 0.36
74 0.37
75 0.38
76 0.4
77 0.37
78 0.38
79 0.32
80 0.32
81 0.29
82 0.29
83 0.26
84 0.24
85 0.23
86 0.26
87 0.25
88 0.27
89 0.29
90 0.31