Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3PZ74

Protein Details
Accession A0A0C3PZ74    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
40-61YTATRGKRTRNFPRHSRPYDYPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto 6.5, mito_nucl 6.5, cysk 5, cyto_pero 5
Family & Domain DBs
Amino Acid Sequences MITCTWDTLTDPCVYDRSVGVLFDRFFTRHLPTPTIPNMYTATRGKRTRNFPRHSRPYDYPGVSQPIPEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.15
4 0.16
5 0.14
6 0.13
7 0.13
8 0.15
9 0.15
10 0.15
11 0.17
12 0.14
13 0.14
14 0.16
15 0.19
16 0.22
17 0.24
18 0.26
19 0.25
20 0.3
21 0.31
22 0.32
23 0.28
24 0.24
25 0.24
26 0.2
27 0.24
28 0.22
29 0.25
30 0.29
31 0.33
32 0.38
33 0.44
34 0.53
35 0.6
36 0.67
37 0.7
38 0.73
39 0.8
40 0.84
41 0.82
42 0.81
43 0.75
44 0.71
45 0.72
46 0.65
47 0.57
48 0.52
49 0.52
50 0.44