Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3JX79

Protein Details
Accession A0A0C3JX79    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
75-97KGGPKTPKSCKEKWKRVRDTYMVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 10.333, cyto_nucl 5.333, nucl 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044822  Myb_DNA-bind_4  
Pfam View protein in Pfam  
PF13837  Myb_DNA-bind_4  
Amino Acid Sequences MPPCKAVKSSNHKGKSRSSRSPDGHSTQVSWSDKDTFALLDFIDSHKATAGDGLNFKAPFWNACATSPMLANPEKGGPKTPKSCKEKWKRVRDTYMVVDHLSHSSGFVYSLKSGADIGVANENSWDGYMKVHKDTAPYKNKGWLFYDRMSALIPSKCKGLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.76
4 0.76
5 0.73
6 0.75
7 0.74
8 0.77
9 0.74
10 0.68
11 0.64
12 0.55
13 0.49
14 0.41
15 0.44
16 0.39
17 0.32
18 0.29
19 0.27
20 0.26
21 0.25
22 0.23
23 0.16
24 0.14
25 0.14
26 0.11
27 0.09
28 0.09
29 0.09
30 0.12
31 0.12
32 0.11
33 0.11
34 0.11
35 0.1
36 0.13
37 0.13
38 0.12
39 0.13
40 0.14
41 0.16
42 0.16
43 0.16
44 0.15
45 0.14
46 0.12
47 0.14
48 0.16
49 0.13
50 0.14
51 0.16
52 0.15
53 0.15
54 0.15
55 0.12
56 0.12
57 0.12
58 0.12
59 0.1
60 0.13
61 0.13
62 0.13
63 0.18
64 0.19
65 0.24
66 0.32
67 0.38
68 0.44
69 0.49
70 0.56
71 0.61
72 0.69
73 0.74
74 0.76
75 0.81
76 0.81
77 0.82
78 0.82
79 0.75
80 0.69
81 0.63
82 0.56
83 0.46
84 0.37
85 0.3
86 0.23
87 0.2
88 0.16
89 0.11
90 0.08
91 0.07
92 0.07
93 0.07
94 0.07
95 0.08
96 0.08
97 0.09
98 0.08
99 0.08
100 0.08
101 0.07
102 0.08
103 0.06
104 0.07
105 0.12
106 0.12
107 0.11
108 0.11
109 0.11
110 0.1
111 0.1
112 0.1
113 0.05
114 0.08
115 0.13
116 0.16
117 0.18
118 0.21
119 0.21
120 0.27
121 0.33
122 0.41
123 0.45
124 0.47
125 0.47
126 0.53
127 0.55
128 0.53
129 0.5
130 0.48
131 0.45
132 0.43
133 0.46
134 0.38
135 0.37
136 0.34
137 0.31
138 0.29
139 0.28
140 0.28
141 0.24