Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3J644

Protein Details
Accession A0A0C3J644    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
50-73GEKLQVPYKQKPKRSIRCQSDTSDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.333, cyto 13, nucl 10.5, cyto_pero 7.665
Family & Domain DBs
Amino Acid Sequences MDLRLTDGKIRHGYLVPTSASDMGPGKLYLDGLAVIIRAEGQMKLATKYGEKLQVPYKQKPKRSIRCQSDTSDTTTMVIEVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.24
4 0.21
5 0.21
6 0.19
7 0.17
8 0.16
9 0.15
10 0.11
11 0.12
12 0.11
13 0.1
14 0.09
15 0.1
16 0.08
17 0.07
18 0.06
19 0.05
20 0.05
21 0.05
22 0.04
23 0.04
24 0.04
25 0.03
26 0.04
27 0.04
28 0.04
29 0.06
30 0.07
31 0.08
32 0.09
33 0.1
34 0.1
35 0.12
36 0.14
37 0.19
38 0.19
39 0.21
40 0.27
41 0.34
42 0.4
43 0.47
44 0.54
45 0.56
46 0.63
47 0.7
48 0.75
49 0.78
50 0.82
51 0.84
52 0.83
53 0.83
54 0.8
55 0.75
56 0.73
57 0.64
58 0.59
59 0.5
60 0.41
61 0.34
62 0.3