Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3IXR1

Protein Details
Accession A0A0C3IXR1    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
27-46QVPKWFQNKGKGKKKEKGTGBasic
NLS Segment(s)
PositionSequence
34-47NKGKGKKKEKGTGK
Subcellular Location(s) mito 17, cyto 5.5, cyto_nucl 5.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences KSTCENCGKKGHTKDQCWEEGGGKAGQVPKWFQNKGKGKKKEKGTGKAATAASASASSSAQTSADLEPDGTILFDSGASRHMSSYCSKFLNYKPIIPKPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.71
3 0.69
4 0.61
5 0.54
6 0.45
7 0.38
8 0.34
9 0.26
10 0.19
11 0.18
12 0.19
13 0.18
14 0.19
15 0.19
16 0.24
17 0.31
18 0.34
19 0.35
20 0.42
21 0.51
22 0.59
23 0.67
24 0.7
25 0.71
26 0.76
27 0.81
28 0.8
29 0.78
30 0.76
31 0.73
32 0.67
33 0.6
34 0.58
35 0.5
36 0.41
37 0.32
38 0.23
39 0.16
40 0.11
41 0.1
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.07
65 0.09
66 0.09
67 0.1
68 0.11
69 0.13
70 0.18
71 0.22
72 0.24
73 0.25
74 0.26
75 0.3
76 0.34
77 0.43
78 0.41
79 0.44
80 0.49