Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3KA19

Protein Details
Accession A0A0C3KA19    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
56-75RDWNRYMGGSRRRQKRRMSDBasic
NLS Segment(s)
PositionSequence
67-71RRQKR
Subcellular Location(s) nucl 17, mito_nucl 12.166, cyto_nucl 10.666, mito 6, cyto_mito 5.166
Family & Domain DBs
Amino Acid Sequences MGSHTNASMPCSFKRSLSRADDCSGTCKCVGKGRMTLVLAPDRFLWSRMNLENNRRDWNRYMGGSRRRQKRRMSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.4
4 0.45
5 0.48
6 0.47
7 0.49
8 0.47
9 0.39
10 0.4
11 0.33
12 0.26
13 0.22
14 0.2
15 0.19
16 0.24
17 0.26
18 0.24
19 0.27
20 0.28
21 0.31
22 0.29
23 0.28
24 0.24
25 0.26
26 0.22
27 0.19
28 0.17
29 0.15
30 0.15
31 0.16
32 0.15
33 0.12
34 0.17
35 0.19
36 0.26
37 0.29
38 0.37
39 0.42
40 0.44
41 0.51
42 0.49
43 0.5
44 0.46
45 0.47
46 0.44
47 0.41
48 0.44
49 0.45
50 0.53
51 0.59
52 0.65
53 0.69
54 0.73
55 0.78