Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PC90

Protein Details
Accession A0A0C3PC90    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
33-57DTPGASTTRRQTRRVKRENVELNDQHydrophilic
84-105VTTTETKSRSPKKPKAIPQSLDHydrophilic
331-353GLCPSAQTKKLSKRDSRNSASTSHydrophilic
NLS Segment(s)
PositionSequence
69-76KKRKAKAK
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
IPR004036  Endonuclease-III-like_CS2  
IPR003265  HhH-GPD_domain  
IPR023170  HhH_base_excis_C  
IPR000445  HhH_motif  
IPR030841  NTH1  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005634  C:nucleus  
GO:0140078  F:class I DNA-(apurinic or apyrimidinic site) endonuclease activity  
GO:0003677  F:DNA binding  
GO:0000703  F:oxidized pyrimidine nucleobase lesion DNA N-glycosylase activity  
GO:0006285  P:base-excision repair, AP site formation  
Pfam View protein in Pfam  
PF00633  HHH  
PF00730  HhH-GPD  
PROSITE View protein in PROSITE  
PS01155  ENDONUCLEASE_III_2  
CDD cd00056  ENDO3c  
Amino Acid Sequences MSAIRRVASERVTRLSAKSSPYHTAVTLYDAQDTPGASTTRRQTRRVKRENVELNDQEGSNDALPAAVKKRKAKAKVVKTATSVTTTETKSRSPKKPKAIPQSLDVPHPTPERWKEAYNAIKEMRSRITAPVDTMGCDQAQWKEQDPKNRRFATLISLMLSSQTKDEVTDAAVAKLRIAIGGSLSVDAVIAAEEATVSEAISKVGFWRRKTQYIKQAAQRLRDDFDSDVPKTVDELCSLPGVGPKMAFLALQVAWNLNLGIGVDVHVHRITNRLGWHQRPTKNPEETRLNLQSWLPKELHGEINHMLVGFGQTVCLPVGPKCDLCTLSSAGLCPSAQTKKLSKRDSRNSASTSRVELDPGPKVEIEVENS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.43
3 0.41
4 0.39
5 0.4
6 0.4
7 0.42
8 0.43
9 0.42
10 0.37
11 0.35
12 0.31
13 0.31
14 0.3
15 0.26
16 0.26
17 0.23
18 0.24
19 0.22
20 0.22
21 0.18
22 0.17
23 0.18
24 0.15
25 0.21
26 0.29
27 0.38
28 0.44
29 0.5
30 0.56
31 0.66
32 0.77
33 0.81
34 0.83
35 0.79
36 0.84
37 0.87
38 0.82
39 0.8
40 0.7
41 0.63
42 0.55
43 0.48
44 0.37
45 0.28
46 0.24
47 0.15
48 0.13
49 0.1
50 0.08
51 0.09
52 0.11
53 0.17
54 0.2
55 0.26
56 0.33
57 0.42
58 0.5
59 0.57
60 0.65
61 0.69
62 0.75
63 0.79
64 0.79
65 0.75
66 0.69
67 0.65
68 0.56
69 0.49
70 0.39
71 0.31
72 0.3
73 0.27
74 0.29
75 0.27
76 0.3
77 0.36
78 0.45
79 0.53
80 0.58
81 0.65
82 0.71
83 0.79
84 0.84
85 0.86
86 0.86
87 0.78
88 0.72
89 0.72
90 0.63
91 0.56
92 0.49
93 0.39
94 0.33
95 0.32
96 0.29
97 0.28
98 0.3
99 0.33
100 0.34
101 0.34
102 0.33
103 0.39
104 0.46
105 0.41
106 0.42
107 0.36
108 0.37
109 0.36
110 0.36
111 0.3
112 0.25
113 0.24
114 0.23
115 0.26
116 0.24
117 0.24
118 0.24
119 0.22
120 0.2
121 0.2
122 0.17
123 0.12
124 0.12
125 0.12
126 0.11
127 0.14
128 0.14
129 0.17
130 0.26
131 0.28
132 0.39
133 0.45
134 0.51
135 0.57
136 0.58
137 0.55
138 0.47
139 0.46
140 0.41
141 0.37
142 0.29
143 0.21
144 0.19
145 0.18
146 0.18
147 0.17
148 0.12
149 0.08
150 0.08
151 0.07
152 0.07
153 0.07
154 0.06
155 0.07
156 0.1
157 0.1
158 0.1
159 0.12
160 0.12
161 0.11
162 0.11
163 0.1
164 0.07
165 0.06
166 0.05
167 0.04
168 0.04
169 0.05
170 0.04
171 0.04
172 0.04
173 0.04
174 0.03
175 0.03
176 0.02
177 0.02
178 0.02
179 0.02
180 0.02
181 0.02
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.04
188 0.04
189 0.04
190 0.06
191 0.14
192 0.19
193 0.2
194 0.3
195 0.34
196 0.43
197 0.5
198 0.55
199 0.58
200 0.63
201 0.66
202 0.63
203 0.68
204 0.62
205 0.62
206 0.58
207 0.5
208 0.43
209 0.38
210 0.33
211 0.25
212 0.26
213 0.25
214 0.22
215 0.22
216 0.2
217 0.19
218 0.18
219 0.19
220 0.15
221 0.11
222 0.11
223 0.1
224 0.1
225 0.1
226 0.1
227 0.1
228 0.11
229 0.1
230 0.09
231 0.08
232 0.09
233 0.09
234 0.08
235 0.06
236 0.08
237 0.08
238 0.09
239 0.09
240 0.08
241 0.08
242 0.09
243 0.08
244 0.05
245 0.05
246 0.04
247 0.04
248 0.04
249 0.05
250 0.06
251 0.06
252 0.09
253 0.09
254 0.09
255 0.09
256 0.13
257 0.13
258 0.15
259 0.18
260 0.24
261 0.31
262 0.36
263 0.45
264 0.5
265 0.55
266 0.6
267 0.65
268 0.65
269 0.67
270 0.66
271 0.64
272 0.63
273 0.6
274 0.61
275 0.59
276 0.51
277 0.43
278 0.42
279 0.41
280 0.35
281 0.36
282 0.28
283 0.24
284 0.27
285 0.28
286 0.33
287 0.27
288 0.29
289 0.26
290 0.27
291 0.25
292 0.22
293 0.18
294 0.12
295 0.12
296 0.09
297 0.08
298 0.07
299 0.06
300 0.08
301 0.08
302 0.09
303 0.09
304 0.09
305 0.15
306 0.17
307 0.18
308 0.19
309 0.24
310 0.24
311 0.24
312 0.27
313 0.24
314 0.23
315 0.23
316 0.22
317 0.18
318 0.19
319 0.17
320 0.15
321 0.19
322 0.21
323 0.24
324 0.29
325 0.38
326 0.46
327 0.56
328 0.65
329 0.69
330 0.74
331 0.82
332 0.86
333 0.85
334 0.82
335 0.78
336 0.73
337 0.69
338 0.61
339 0.55
340 0.48
341 0.41
342 0.36
343 0.34
344 0.34
345 0.35
346 0.34
347 0.32
348 0.28
349 0.28
350 0.3