Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3NM06

Protein Details
Accession A0A0C3NM06    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
69-92TGNPQLWRRRKNKNRDRRRIVGIGHydrophilic
NLS Segment(s)
PositionSequence
76-87RRRKNKNRDRRR
Subcellular Location(s) mito 22, extr 2, nucl 1, cyto 1, plas 1, cyto_nucl 1
Family & Domain DBs
Amino Acid Sequences MVFLVRCNPTGAVRTPGTRLSAPYSCYRSLVTAKAVPVLVPVDKPWGTGTAGRNSTRVMVFPANERVITGNPQLWRRRKNKNRDRRRIVGIGVLHFWPPSVPQDKRFRANKGLCWPSCVSRERRQSQIYGTLRLVRAGTKTGQADD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.31
4 0.33
5 0.29
6 0.29
7 0.29
8 0.3
9 0.3
10 0.34
11 0.36
12 0.33
13 0.34
14 0.32
15 0.29
16 0.29
17 0.29
18 0.27
19 0.25
20 0.24
21 0.25
22 0.24
23 0.2
24 0.18
25 0.17
26 0.14
27 0.11
28 0.11
29 0.14
30 0.14
31 0.15
32 0.14
33 0.14
34 0.15
35 0.19
36 0.22
37 0.24
38 0.28
39 0.28
40 0.28
41 0.27
42 0.28
43 0.23
44 0.2
45 0.16
46 0.14
47 0.14
48 0.16
49 0.19
50 0.18
51 0.17
52 0.17
53 0.15
54 0.14
55 0.16
56 0.14
57 0.13
58 0.15
59 0.2
60 0.27
61 0.32
62 0.4
63 0.44
64 0.55
65 0.61
66 0.7
67 0.75
68 0.79
69 0.84
70 0.87
71 0.89
72 0.84
73 0.81
74 0.73
75 0.63
76 0.57
77 0.48
78 0.38
79 0.31
80 0.25
81 0.19
82 0.15
83 0.14
84 0.09
85 0.09
86 0.13
87 0.18
88 0.2
89 0.27
90 0.38
91 0.43
92 0.51
93 0.55
94 0.56
95 0.59
96 0.62
97 0.62
98 0.62
99 0.66
100 0.58
101 0.58
102 0.55
103 0.49
104 0.5
105 0.49
106 0.46
107 0.46
108 0.57
109 0.56
110 0.62
111 0.61
112 0.58
113 0.56
114 0.59
115 0.53
116 0.48
117 0.45
118 0.44
119 0.41
120 0.39
121 0.35
122 0.27
123 0.26
124 0.25
125 0.24
126 0.24