Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PI87

Protein Details
Accession A0A0C3PI87    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-34RHRLCLSPRGGKRRRSVRRSSYLDPBasic
NLS Segment(s)
PositionSequence
18-28RGGKRRRSVRR
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
Amino Acid Sequences RLLRFHQLIRHRLCLSPRGGKRRRSVRRSSYLDPPERGKARSYSVSLRTTQTSLPSAYLIRRDFTSRRCLVNLPWKNRSSASTMHTARYNPCTVSRRDRREGMPLYHPGYILSWARTRSSNTRSSSVTFAVLNVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.51
3 0.52
4 0.54
5 0.58
6 0.63
7 0.67
8 0.73
9 0.77
10 0.81
11 0.8
12 0.82
13 0.81
14 0.84
15 0.84
16 0.78
17 0.77
18 0.76
19 0.73
20 0.66
21 0.6
22 0.57
23 0.53
24 0.5
25 0.42
26 0.36
27 0.35
28 0.36
29 0.35
30 0.33
31 0.36
32 0.37
33 0.36
34 0.35
35 0.32
36 0.29
37 0.27
38 0.23
39 0.19
40 0.17
41 0.16
42 0.14
43 0.14
44 0.13
45 0.18
46 0.16
47 0.15
48 0.16
49 0.19
50 0.21
51 0.23
52 0.3
53 0.27
54 0.28
55 0.29
56 0.29
57 0.29
58 0.38
59 0.42
60 0.4
61 0.44
62 0.43
63 0.43
64 0.43
65 0.41
66 0.33
67 0.3
68 0.26
69 0.28
70 0.29
71 0.29
72 0.3
73 0.3
74 0.29
75 0.29
76 0.28
77 0.21
78 0.27
79 0.29
80 0.32
81 0.41
82 0.48
83 0.52
84 0.56
85 0.6
86 0.55
87 0.61
88 0.62
89 0.55
90 0.52
91 0.49
92 0.46
93 0.42
94 0.4
95 0.31
96 0.26
97 0.26
98 0.21
99 0.19
100 0.2
101 0.21
102 0.23
103 0.25
104 0.3
105 0.34
106 0.39
107 0.43
108 0.44
109 0.47
110 0.48
111 0.48
112 0.47
113 0.4
114 0.36
115 0.28