Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DX50

Protein Details
Accession E9DX50   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
273-297TSLASAPRQERRKRLRLQYLGLRLGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15, cyto_nucl 11.5, nucl 6, mito 3
Family & Domain DBs
KEGG maw:MAC_02198  -  
Amino Acid Sequences MNGKHIYVLLSTVLCLHQPMEHGSALLMIRGGTNLYIRGGEGDLDEDCDEEDLKELTDADDSVDEGSGAQEEDGVDIDTIEKATPECLQRVSKALEPVRAKFKGKEGSQPGLVPEMKQALCNAAPVQPQDAQRCSQRVDELFANVRNQNEAGAVVQLLNKEDVDKFSAAPEKFDKDVCARRGGVYDLNGSQGKPGPGPTGSTPPKEGEQPTDSDKNKDKEVAPVPGGGASGSSVATTVLGGLFGTALTAAGGAGLYFFAQSAEGAALLTSLGTSLASAPRQERRKRLRLQYLGLRLGLERKSVRLSRGRLHEWDIGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.11
4 0.1
5 0.13
6 0.16
7 0.18
8 0.18
9 0.17
10 0.17
11 0.19
12 0.18
13 0.16
14 0.12
15 0.09
16 0.09
17 0.09
18 0.09
19 0.07
20 0.08
21 0.09
22 0.09
23 0.1
24 0.09
25 0.11
26 0.11
27 0.1
28 0.09
29 0.1
30 0.09
31 0.11
32 0.11
33 0.1
34 0.09
35 0.09
36 0.09
37 0.08
38 0.09
39 0.08
40 0.08
41 0.08
42 0.08
43 0.08
44 0.09
45 0.09
46 0.08
47 0.08
48 0.08
49 0.08
50 0.07
51 0.07
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.05
70 0.07
71 0.1
72 0.12
73 0.13
74 0.17
75 0.19
76 0.2
77 0.24
78 0.26
79 0.26
80 0.31
81 0.32
82 0.36
83 0.37
84 0.39
85 0.43
86 0.43
87 0.43
88 0.37
89 0.42
90 0.42
91 0.41
92 0.46
93 0.44
94 0.45
95 0.44
96 0.42
97 0.36
98 0.32
99 0.31
100 0.22
101 0.18
102 0.19
103 0.17
104 0.17
105 0.17
106 0.14
107 0.14
108 0.15
109 0.14
110 0.13
111 0.14
112 0.14
113 0.16
114 0.18
115 0.21
116 0.24
117 0.25
118 0.24
119 0.26
120 0.27
121 0.27
122 0.24
123 0.24
124 0.21
125 0.23
126 0.21
127 0.2
128 0.21
129 0.21
130 0.21
131 0.19
132 0.18
133 0.16
134 0.15
135 0.13
136 0.1
137 0.09
138 0.07
139 0.05
140 0.05
141 0.05
142 0.06
143 0.06
144 0.06
145 0.06
146 0.06
147 0.07
148 0.07
149 0.07
150 0.09
151 0.09
152 0.09
153 0.1
154 0.17
155 0.16
156 0.18
157 0.19
158 0.19
159 0.2
160 0.2
161 0.2
162 0.19
163 0.26
164 0.26
165 0.28
166 0.26
167 0.26
168 0.27
169 0.26
170 0.23
171 0.17
172 0.18
173 0.14
174 0.17
175 0.16
176 0.15
177 0.14
178 0.15
179 0.14
180 0.12
181 0.13
182 0.12
183 0.12
184 0.15
185 0.15
186 0.22
187 0.24
188 0.26
189 0.27
190 0.26
191 0.27
192 0.29
193 0.28
194 0.24
195 0.24
196 0.24
197 0.28
198 0.34
199 0.34
200 0.36
201 0.42
202 0.39
203 0.39
204 0.4
205 0.36
206 0.36
207 0.39
208 0.38
209 0.32
210 0.3
211 0.28
212 0.25
213 0.24
214 0.15
215 0.11
216 0.06
217 0.06
218 0.05
219 0.05
220 0.04
221 0.04
222 0.05
223 0.04
224 0.04
225 0.03
226 0.04
227 0.03
228 0.03
229 0.03
230 0.03
231 0.03
232 0.03
233 0.03
234 0.03
235 0.03
236 0.03
237 0.03
238 0.03
239 0.03
240 0.03
241 0.03
242 0.03
243 0.03
244 0.03
245 0.03
246 0.04
247 0.04
248 0.05
249 0.05
250 0.05
251 0.05
252 0.05
253 0.05
254 0.04
255 0.04
256 0.03
257 0.03
258 0.03
259 0.03
260 0.03
261 0.05
262 0.09
263 0.11
264 0.13
265 0.18
266 0.27
267 0.37
268 0.44
269 0.53
270 0.6
271 0.69
272 0.76
273 0.82
274 0.85
275 0.83
276 0.84
277 0.83
278 0.81
279 0.75
280 0.65
281 0.56
282 0.45
283 0.43
284 0.37
285 0.33
286 0.26
287 0.26
288 0.33
289 0.36
290 0.42
291 0.45
292 0.49
293 0.52
294 0.59
295 0.62
296 0.58
297 0.61