Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3KNE9

Protein Details
Accession A0A0C3KNE9   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAGGSLGKKKTRRKKEIDKADSRRCLLHydrophilic
NLS Segment(s)
PositionSequence
7-16GKKKTRRKKE
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MAGGSLGKKKTRRKKEIDKADSRRCLLARENDSLKDSPSTSTPQTSSRGSSVGSARTSSIRKFLPQKIQAILNLSYQVVPLIHCSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.89
3 0.92
4 0.92
5 0.92
6 0.9
7 0.9
8 0.85
9 0.76
10 0.69
11 0.58
12 0.51
13 0.46
14 0.45
15 0.4
16 0.39
17 0.4
18 0.37
19 0.39
20 0.36
21 0.31
22 0.24
23 0.2
24 0.16
25 0.15
26 0.17
27 0.15
28 0.17
29 0.17
30 0.18
31 0.2
32 0.2
33 0.2
34 0.18
35 0.17
36 0.16
37 0.17
38 0.17
39 0.17
40 0.17
41 0.15
42 0.16
43 0.19
44 0.21
45 0.19
46 0.22
47 0.2
48 0.24
49 0.31
50 0.37
51 0.44
52 0.47
53 0.5
54 0.48
55 0.49
56 0.46
57 0.43
58 0.37
59 0.29
60 0.25
61 0.22
62 0.19
63 0.16
64 0.15
65 0.11
66 0.1
67 0.12