Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7TL55

Protein Details
Accession A7TL55    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAAPRESKKKTTRRKKDPNAPKRALSHydrophilic
NLS Segment(s)
PositionSequence
5-23RESKKKTTRRKKDPNAPKR
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG vpo:Kpol_1065p34  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAAPRESKKKTTRRKKDPNAPKRALSAYMFFANETRDIVKAENPDVSFGQVGRILGEKWKAMTDEDKQPFDAKAEADKKRYESEKELYNATRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.94
3 0.95
4 0.95
5 0.95
6 0.94
7 0.88
8 0.79
9 0.72
10 0.63
11 0.56
12 0.47
13 0.38
14 0.31
15 0.28
16 0.25
17 0.21
18 0.19
19 0.16
20 0.15
21 0.13
22 0.11
23 0.09
24 0.1
25 0.1
26 0.13
27 0.13
28 0.14
29 0.16
30 0.15
31 0.16
32 0.15
33 0.15
34 0.12
35 0.1
36 0.1
37 0.08
38 0.08
39 0.07
40 0.08
41 0.07
42 0.09
43 0.11
44 0.1
45 0.1
46 0.11
47 0.12
48 0.12
49 0.17
50 0.19
51 0.27
52 0.31
53 0.32
54 0.32
55 0.33
56 0.32
57 0.29
58 0.27
59 0.18
60 0.22
61 0.3
62 0.33
63 0.36
64 0.39
65 0.41
66 0.46
67 0.5
68 0.47
69 0.45
70 0.46
71 0.5
72 0.49
73 0.51