Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3N3R8

Protein Details
Accession A0A0C3N3R8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
70-89QTSTRKRRTPVRQPRNFALNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, mito 6, extr 4, E.R. 4
Family & Domain DBs
Amino Acid Sequences MFSMCLFTLLTTIVLLFLCSPAVRKSLIAGDDTLDAHEAGIVFVASRNPIRETGPPACMAKLIMLRHKMQTSTRKRRTPVRQPRNFALNQHPRPRASWVRLGRPFGGKNYH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.06
6 0.06
7 0.08
8 0.09
9 0.11
10 0.11
11 0.11
12 0.13
13 0.16
14 0.17
15 0.17
16 0.15
17 0.15
18 0.15
19 0.15
20 0.13
21 0.1
22 0.09
23 0.07
24 0.07
25 0.06
26 0.05
27 0.05
28 0.04
29 0.03
30 0.04
31 0.05
32 0.05
33 0.06
34 0.08
35 0.09
36 0.1
37 0.13
38 0.14
39 0.2
40 0.21
41 0.22
42 0.22
43 0.22
44 0.2
45 0.19
46 0.16
47 0.12
48 0.14
49 0.14
50 0.17
51 0.2
52 0.21
53 0.24
54 0.25
55 0.25
56 0.28
57 0.36
58 0.43
59 0.51
60 0.59
61 0.62
62 0.65
63 0.73
64 0.78
65 0.79
66 0.79
67 0.79
68 0.79
69 0.8
70 0.81
71 0.79
72 0.7
73 0.64
74 0.63
75 0.63
76 0.62
77 0.64
78 0.63
79 0.57
80 0.57
81 0.61
82 0.6
83 0.54
84 0.56
85 0.54
86 0.6
87 0.65
88 0.67
89 0.62
90 0.61
91 0.58