Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PG32

Protein Details
Accession A0A0C3PG32    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
90-117GASAPPPNKNAKRRAKQRAKKASETTEAHydrophilic
NLS Segment(s)
PositionSequence
86-110KAKPGASAPPPNKNAKRRAKQRAKK
Subcellular Location(s) mito 9, nucl 8.5, cyto_nucl 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
IPR015362  WIBG_mago-bd  
IPR036348  WIBG_N_sf  
Gene Ontology GO:1903259  P:exon-exon junction complex disassembly  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MSRPPVFPEQTASGIAVDPRTLERVVPETRRPDGSVRKQLKIRPGFTPQEDVSRFRGTRQKAMDATALPKGHILGWVAPSSEPQQKAKPGASAPPPNKNAKRRAKQRAKKASETTEAVKSNWDDEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.15
4 0.11
5 0.1
6 0.11
7 0.13
8 0.12
9 0.12
10 0.13
11 0.18
12 0.23
13 0.28
14 0.32
15 0.35
16 0.37
17 0.4
18 0.39
19 0.41
20 0.45
21 0.5
22 0.55
23 0.55
24 0.57
25 0.59
26 0.61
27 0.64
28 0.61
29 0.54
30 0.49
31 0.5
32 0.49
33 0.46
34 0.48
35 0.39
36 0.39
37 0.37
38 0.35
39 0.32
40 0.33
41 0.31
42 0.29
43 0.35
44 0.3
45 0.35
46 0.35
47 0.36
48 0.31
49 0.33
50 0.31
51 0.26
52 0.25
53 0.23
54 0.2
55 0.15
56 0.15
57 0.13
58 0.11
59 0.12
60 0.11
61 0.08
62 0.09
63 0.1
64 0.1
65 0.1
66 0.11
67 0.13
68 0.18
69 0.19
70 0.2
71 0.24
72 0.27
73 0.31
74 0.31
75 0.31
76 0.27
77 0.31
78 0.36
79 0.42
80 0.42
81 0.48
82 0.51
83 0.57
84 0.64
85 0.65
86 0.68
87 0.69
88 0.76
89 0.77
90 0.84
91 0.86
92 0.88
93 0.91
94 0.92
95 0.89
96 0.87
97 0.85
98 0.81
99 0.76
100 0.71
101 0.64
102 0.6
103 0.54
104 0.45
105 0.42
106 0.36
107 0.31