Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3NPV8

Protein Details
Accession A0A0C3NPV8    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20KSTCKNCRKKGHVQDQCWEEHydrophilic
27-47QVPKWFQNKGKGKKKEKGSGKBasic
NLS Segment(s)
PositionSequence
34-46NKGKGKKKEKGSG
Subcellular Location(s) mito 17, cyto_nucl 5, nucl 4, cyto 4
Family & Domain DBs
Amino Acid Sequences KSTCKNCRKKGHVQDQCWEEGGGKAGQVPKWFQNKGKGKKKEKGSGKVATAASISASLNAYMNTFDHGLLAGESLNSTKETILFDSGMSCHMSSYCSKFLDYKPIIPKPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.75
3 0.69
4 0.59
5 0.48
6 0.37
7 0.28
8 0.25
9 0.17
10 0.13
11 0.13
12 0.15
13 0.17
14 0.18
15 0.2
16 0.24
17 0.32
18 0.35
19 0.36
20 0.43
21 0.52
22 0.6
23 0.68
24 0.71
25 0.72
26 0.77
27 0.82
28 0.81
29 0.79
30 0.77
31 0.74
32 0.69
33 0.62
34 0.6
35 0.51
36 0.42
37 0.33
38 0.24
39 0.17
40 0.12
41 0.11
42 0.06
43 0.06
44 0.05
45 0.06
46 0.06
47 0.06
48 0.05
49 0.06
50 0.06
51 0.07
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.04
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.06
65 0.06
66 0.07
67 0.09
68 0.1
69 0.12
70 0.11
71 0.11
72 0.12
73 0.12
74 0.12
75 0.12
76 0.1
77 0.09
78 0.09
79 0.11
80 0.13
81 0.19
82 0.22
83 0.22
84 0.23
85 0.28
86 0.3
87 0.39
88 0.39
89 0.41
90 0.46