Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PD70

Protein Details
Accession A0A0C3PD70   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
31-74SAKTPTKKAKHGCKQKQSNSPSSPKSPASKKKKKTMKLMSKTAIHydrophilic
NLS Segment(s)
PositionSequence
27-66PKRISAKTPTKKAKHGCKQKQSNSPSSPKSPASKKKKKTM
Subcellular Location(s) nucl 23, cyto 4
Family & Domain DBs
Amino Acid Sequences MFIDDAYIPPYDSVTSTLVASPVKNSPKRISAKTPTKKAKHGCKQKQSNSPSSPKSPASKKKKKTMKLMSKTAIFDISNLEDSVAEPPPQSITAHLHLETSVKVLACT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.13
5 0.14
6 0.14
7 0.13
8 0.13
9 0.18
10 0.26
11 0.29
12 0.34
13 0.36
14 0.44
15 0.5
16 0.53
17 0.55
18 0.56
19 0.64
20 0.68
21 0.74
22 0.75
23 0.74
24 0.76
25 0.76
26 0.77
27 0.76
28 0.78
29 0.78
30 0.79
31 0.85
32 0.85
33 0.85
34 0.8
35 0.79
36 0.73
37 0.69
38 0.63
39 0.56
40 0.51
41 0.45
42 0.45
43 0.45
44 0.49
45 0.54
46 0.6
47 0.64
48 0.7
49 0.77
50 0.79
51 0.81
52 0.82
53 0.82
54 0.8
55 0.81
56 0.75
57 0.7
58 0.63
59 0.53
60 0.45
61 0.33
62 0.25
63 0.2
64 0.18
65 0.15
66 0.14
67 0.13
68 0.11
69 0.11
70 0.13
71 0.12
72 0.11
73 0.1
74 0.1
75 0.12
76 0.13
77 0.13
78 0.13
79 0.17
80 0.21
81 0.24
82 0.23
83 0.22
84 0.22
85 0.23
86 0.2
87 0.17
88 0.15