Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3KBN6

Protein Details
Accession A0A0C3KBN6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MRKTKRRGKRHWNELRVKLRFPBasic
NLS Segment(s)
PositionSequence
3-11KTKRRGKRH
Subcellular Location(s) mito 16.5, mito_nucl 13.333, nucl 9, cyto_nucl 5.833
Family & Domain DBs
Amino Acid Sequences MRKTKRRGKRHWNELRVKLRFPQGTASPEKTAFWANEMDSPHLIFLPNEKSSSRPELRPRMIQLTTLRQWMKRQGSDHEDGPSFLRHFLQRYTRLHSNIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.84
4 0.75
5 0.69
6 0.67
7 0.58
8 0.5
9 0.45
10 0.4
11 0.41
12 0.44
13 0.43
14 0.36
15 0.35
16 0.34
17 0.29
18 0.27
19 0.22
20 0.18
21 0.15
22 0.14
23 0.17
24 0.17
25 0.18
26 0.15
27 0.15
28 0.14
29 0.12
30 0.12
31 0.08
32 0.09
33 0.12
34 0.13
35 0.14
36 0.14
37 0.15
38 0.18
39 0.26
40 0.26
41 0.27
42 0.34
43 0.42
44 0.45
45 0.48
46 0.48
47 0.46
48 0.44
49 0.43
50 0.39
51 0.37
52 0.35
53 0.37
54 0.36
55 0.32
56 0.35
57 0.4
58 0.43
59 0.4
60 0.42
61 0.42
62 0.47
63 0.49
64 0.48
65 0.43
66 0.37
67 0.33
68 0.32
69 0.29
70 0.23
71 0.21
72 0.22
73 0.2
74 0.22
75 0.28
76 0.35
77 0.39
78 0.43
79 0.5
80 0.54