Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3J8I9

Protein Details
Accession A0A0C3J8I9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-28NEMPSYSFRRRCPRRSYRTFFKVLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MRLNEMPSYSFRRRCPRRSYRTFFKVLLGMVHWRYPASSDTSSLFRVGTLRPLKLTTHSAQVDGNILQDCLQAPLSRVPTVFTELVTITQTVRTPPCHIDILMQVITVFLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.76
3 0.79
4 0.82
5 0.86
6 0.88
7 0.87
8 0.85
9 0.82
10 0.72
11 0.63
12 0.55
13 0.44
14 0.36
15 0.27
16 0.24
17 0.2
18 0.2
19 0.18
20 0.15
21 0.15
22 0.15
23 0.15
24 0.16
25 0.15
26 0.16
27 0.17
28 0.19
29 0.2
30 0.19
31 0.17
32 0.11
33 0.12
34 0.11
35 0.17
36 0.18
37 0.17
38 0.18
39 0.19
40 0.2
41 0.21
42 0.25
43 0.18
44 0.22
45 0.22
46 0.22
47 0.2
48 0.2
49 0.19
50 0.15
51 0.15
52 0.08
53 0.08
54 0.07
55 0.08
56 0.08
57 0.07
58 0.08
59 0.07
60 0.09
61 0.13
62 0.16
63 0.16
64 0.16
65 0.16
66 0.17
67 0.21
68 0.2
69 0.15
70 0.14
71 0.14
72 0.15
73 0.14
74 0.13
75 0.09
76 0.11
77 0.12
78 0.14
79 0.17
80 0.19
81 0.22
82 0.24
83 0.27
84 0.28
85 0.27
86 0.27
87 0.27
88 0.3
89 0.26
90 0.23
91 0.19