Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PDN0

Protein Details
Accession A0A0C3PDN0    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
6-30CESLCRGRRKGREKGVWSRQQNKDRHydrophilic
NLS Segment(s)
PositionSequence
13-18RRKGRE
Subcellular Location(s) mito 13, nucl 10, cyto 2
Family & Domain DBs
Amino Acid Sequences MREGGCESLCRGRRKGREKGVWSRQQNKDRHRTGNHDLQEHPPLYQLPAQSTLDVSHSVRGWETGGIYDRGKETMSVEARVVKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.7
3 0.71
4 0.75
5 0.78
6 0.83
7 0.84
8 0.83
9 0.83
10 0.82
11 0.81
12 0.8
13 0.8
14 0.78
15 0.78
16 0.74
17 0.74
18 0.69
19 0.67
20 0.64
21 0.65
22 0.59
23 0.51
24 0.47
25 0.42
26 0.42
27 0.34
28 0.28
29 0.2
30 0.17
31 0.16
32 0.16
33 0.14
34 0.11
35 0.15
36 0.15
37 0.14
38 0.15
39 0.14
40 0.13
41 0.14
42 0.13
43 0.12
44 0.12
45 0.12
46 0.12
47 0.12
48 0.11
49 0.1
50 0.1
51 0.1
52 0.12
53 0.14
54 0.15
55 0.16
56 0.16
57 0.16
58 0.16
59 0.14
60 0.14
61 0.2
62 0.22
63 0.22
64 0.23