Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3P966

Protein Details
Accession A0A0C3P966   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
50-69LGRKSCPKHVPLQKHKQIDRBasic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 2.5, cyto_nucl 2.5, pero 2
Family & Domain DBs
Amino Acid Sequences MSWFTQAAPLRLYTIQSTLTFQFKEEPNQALRLSIGKRWEVKLLQVACALGRKSCPKHVPLQKHKQIDRVSACV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.2
5 0.19
6 0.22
7 0.2
8 0.19
9 0.22
10 0.21
11 0.26
12 0.26
13 0.27
14 0.25
15 0.28
16 0.27
17 0.22
18 0.21
19 0.19
20 0.18
21 0.17
22 0.18
23 0.18
24 0.19
25 0.2
26 0.23
27 0.2
28 0.2
29 0.25
30 0.23
31 0.22
32 0.2
33 0.19
34 0.16
35 0.19
36 0.18
37 0.12
38 0.15
39 0.21
40 0.24
41 0.33
42 0.37
43 0.37
44 0.47
45 0.56
46 0.64
47 0.67
48 0.75
49 0.75
50 0.8
51 0.8
52 0.78
53 0.74
54 0.72