Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3NX45

Protein Details
Accession A0A0C3NX45   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
179-199MSPHTGEKKKRSRHPSAKVLEBasic
NLS Segment(s)
PositionSequence
173-176KRKA
181-193PHTGEKKKRSRHP
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MSIRRSRTPYDQELLPDLTWATSEELRVGSDDDDEAIRGKLAERKRCKAKAQEEARLEAERQEQAWLEEERAHAEAEAQRVEAACKAEEARKVEESRRADALVGSSAGAGSNVEVMDPHCLRCTWTNMTCLCSTDSKKRRLACNWCNELKEHCRWPVEGETSQGTGLGADKGKRKADVMSPHTGEKKKRSRHPSAKVLEGAGDEEDDVEEGPSTKKTGAEAGASPVTGDQMERLIKAVERVADNVVGLTVAQREVSRNFYWFARSYETYVEEHFEFLAPDVPSDRDTTDEEDRDAEGLDEELAGLREEEEESRSRSESGDQAGAGPAGSQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.4
3 0.32
4 0.25
5 0.2
6 0.17
7 0.15
8 0.14
9 0.12
10 0.13
11 0.14
12 0.14
13 0.15
14 0.15
15 0.15
16 0.12
17 0.12
18 0.12
19 0.11
20 0.11
21 0.11
22 0.11
23 0.1
24 0.1
25 0.09
26 0.11
27 0.17
28 0.25
29 0.35
30 0.42
31 0.51
32 0.61
33 0.68
34 0.74
35 0.78
36 0.79
37 0.79
38 0.79
39 0.79
40 0.72
41 0.69
42 0.63
43 0.55
44 0.46
45 0.39
46 0.34
47 0.26
48 0.23
49 0.21
50 0.19
51 0.18
52 0.22
53 0.19
54 0.16
55 0.17
56 0.17
57 0.18
58 0.18
59 0.17
60 0.13
61 0.15
62 0.16
63 0.17
64 0.17
65 0.15
66 0.14
67 0.14
68 0.15
69 0.14
70 0.13
71 0.11
72 0.11
73 0.13
74 0.17
75 0.21
76 0.24
77 0.25
78 0.29
79 0.32
80 0.34
81 0.41
82 0.4
83 0.39
84 0.37
85 0.34
86 0.29
87 0.26
88 0.24
89 0.17
90 0.13
91 0.1
92 0.08
93 0.07
94 0.07
95 0.06
96 0.05
97 0.03
98 0.04
99 0.04
100 0.04
101 0.04
102 0.05
103 0.1
104 0.11
105 0.11
106 0.11
107 0.12
108 0.14
109 0.17
110 0.22
111 0.22
112 0.24
113 0.29
114 0.29
115 0.32
116 0.3
117 0.28
118 0.25
119 0.24
120 0.25
121 0.3
122 0.37
123 0.41
124 0.46
125 0.49
126 0.55
127 0.59
128 0.66
129 0.63
130 0.66
131 0.65
132 0.63
133 0.59
134 0.54
135 0.5
136 0.45
137 0.42
138 0.36
139 0.32
140 0.3
141 0.3
142 0.31
143 0.3
144 0.29
145 0.25
146 0.23
147 0.2
148 0.2
149 0.19
150 0.16
151 0.11
152 0.07
153 0.07
154 0.07
155 0.07
156 0.09
157 0.13
158 0.16
159 0.18
160 0.18
161 0.18
162 0.19
163 0.24
164 0.31
165 0.32
166 0.34
167 0.35
168 0.37
169 0.41
170 0.43
171 0.41
172 0.42
173 0.46
174 0.49
175 0.57
176 0.63
177 0.69
178 0.75
179 0.8
180 0.81
181 0.75
182 0.71
183 0.63
184 0.54
185 0.44
186 0.33
187 0.25
188 0.15
189 0.12
190 0.07
191 0.06
192 0.05
193 0.04
194 0.04
195 0.04
196 0.04
197 0.04
198 0.05
199 0.06
200 0.07
201 0.08
202 0.08
203 0.09
204 0.12
205 0.12
206 0.14
207 0.14
208 0.16
209 0.16
210 0.15
211 0.15
212 0.12
213 0.11
214 0.09
215 0.08
216 0.05
217 0.08
218 0.09
219 0.09
220 0.1
221 0.1
222 0.11
223 0.12
224 0.14
225 0.13
226 0.13
227 0.15
228 0.15
229 0.15
230 0.14
231 0.12
232 0.1
233 0.08
234 0.06
235 0.06
236 0.05
237 0.05
238 0.06
239 0.07
240 0.09
241 0.12
242 0.17
243 0.18
244 0.19
245 0.21
246 0.21
247 0.25
248 0.25
249 0.26
250 0.27
251 0.27
252 0.28
253 0.29
254 0.31
255 0.27
256 0.26
257 0.26
258 0.2
259 0.19
260 0.17
261 0.14
262 0.12
263 0.11
264 0.16
265 0.12
266 0.13
267 0.14
268 0.15
269 0.16
270 0.17
271 0.17
272 0.14
273 0.17
274 0.22
275 0.26
276 0.27
277 0.26
278 0.26
279 0.26
280 0.24
281 0.22
282 0.17
283 0.1
284 0.09
285 0.08
286 0.07
287 0.06
288 0.07
289 0.07
290 0.07
291 0.06
292 0.06
293 0.07
294 0.09
295 0.1
296 0.12
297 0.15
298 0.18
299 0.21
300 0.22
301 0.22
302 0.22
303 0.25
304 0.26
305 0.28
306 0.27
307 0.25
308 0.24
309 0.25
310 0.23
311 0.19