Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9E209

Protein Details
Accession E9E209   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
23-45HVERLRKTFRTNKTKDMNFRLQQHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12, cyto_mito 9.833, cyto_nucl 7.333, mito 6.5, pero 4, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016161  Ald_DH/histidinol_DH  
IPR016163  Ald_DH_C  
IPR016162  Ald_DH_N  
IPR015590  Aldehyde_DH_dom  
IPR012394  Aldehyde_DH_NAD(P)  
Gene Ontology GO:0016020  C:membrane  
GO:0016620  F:oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor  
GO:0006081  P:cellular aldehyde metabolic process  
KEGG maw:MAC_03864  -  
Pfam View protein in Pfam  
PF00171  Aldedh  
Amino Acid Sequences MAHVKAGPIPAFEPAALDDITAHVERLRKTFRTNKTKDMNFRLQQIRKLYWAVSDYEQLIEEAVMKDMGKCKFEAHVTEIDWVKNEAINVANKLETWAKDEYVVDLPMTYWPMRPRIRNEPLGQVLIIGAYNFPFQLNLTPVIGAIAAGNCVILKPSELSPHSAMILKKIFDEYLDPDCYVCVNGALEETKHVMEHKFDKIVFTGGKKTGAIIATKAAQSLTPVLLELGGQNPAFITKNGDVKLAARRLLWQKCLNAGQVCLSHNYVLIERPVLNEFIAEVNKQYRIFMPKGAKDSDLSRIVNKGHFDRLMRMLNNSKGKIVMGGGSDEERLWIEPTAVLVDDVEDTMMAEESFGPIWSIMPFDNLDEAIDIANKVDPTPLALFTFGSDEENNKVLNNVTSGGATVNDAFFHAMINATPLGGIGSSGQGSYHGYYSFKAFSHQRIITQVPKWAEKLLRVRYMPYSWDELSRYRMMNGQKPNFDRDGNVNQGLKYWLSFVFGLGGKSTSGAAVRWGIILALIAMFLRLKRNSLGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.14
4 0.14
5 0.11
6 0.11
7 0.15
8 0.14
9 0.13
10 0.13
11 0.18
12 0.2
13 0.28
14 0.34
15 0.34
16 0.42
17 0.52
18 0.6
19 0.66
20 0.7
21 0.72
22 0.75
23 0.81
24 0.82
25 0.81
26 0.81
27 0.74
28 0.77
29 0.77
30 0.72
31 0.7
32 0.68
33 0.61
34 0.55
35 0.54
36 0.45
37 0.39
38 0.36
39 0.33
40 0.28
41 0.28
42 0.25
43 0.23
44 0.23
45 0.18
46 0.16
47 0.13
48 0.12
49 0.1
50 0.1
51 0.1
52 0.09
53 0.12
54 0.18
55 0.21
56 0.2
57 0.2
58 0.21
59 0.25
60 0.28
61 0.3
62 0.28
63 0.3
64 0.3
65 0.34
66 0.35
67 0.31
68 0.29
69 0.26
70 0.22
71 0.19
72 0.17
73 0.14
74 0.15
75 0.18
76 0.18
77 0.18
78 0.18
79 0.17
80 0.19
81 0.22
82 0.19
83 0.2
84 0.2
85 0.19
86 0.21
87 0.21
88 0.22
89 0.2
90 0.2
91 0.16
92 0.14
93 0.14
94 0.13
95 0.16
96 0.13
97 0.14
98 0.17
99 0.26
100 0.31
101 0.37
102 0.43
103 0.5
104 0.57
105 0.61
106 0.61
107 0.6
108 0.58
109 0.53
110 0.46
111 0.35
112 0.27
113 0.2
114 0.17
115 0.09
116 0.06
117 0.05
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.09
124 0.11
125 0.12
126 0.12
127 0.12
128 0.12
129 0.12
130 0.11
131 0.08
132 0.06
133 0.05
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.05
140 0.04
141 0.05
142 0.07
143 0.08
144 0.14
145 0.16
146 0.2
147 0.21
148 0.22
149 0.22
150 0.24
151 0.23
152 0.22
153 0.24
154 0.2
155 0.19
156 0.19
157 0.18
158 0.15
159 0.17
160 0.16
161 0.18
162 0.19
163 0.18
164 0.17
165 0.17
166 0.17
167 0.15
168 0.11
169 0.06
170 0.05
171 0.05
172 0.06
173 0.07
174 0.07
175 0.07
176 0.09
177 0.08
178 0.08
179 0.1
180 0.1
181 0.13
182 0.17
183 0.19
184 0.21
185 0.2
186 0.21
187 0.21
188 0.23
189 0.21
190 0.19
191 0.21
192 0.19
193 0.2
194 0.19
195 0.18
196 0.18
197 0.18
198 0.16
199 0.12
200 0.12
201 0.13
202 0.13
203 0.13
204 0.1
205 0.08
206 0.09
207 0.09
208 0.08
209 0.06
210 0.06
211 0.06
212 0.06
213 0.06
214 0.06
215 0.05
216 0.06
217 0.06
218 0.06
219 0.06
220 0.07
221 0.08
222 0.08
223 0.11
224 0.12
225 0.16
226 0.17
227 0.18
228 0.17
229 0.18
230 0.24
231 0.22
232 0.21
233 0.17
234 0.21
235 0.29
236 0.31
237 0.35
238 0.32
239 0.31
240 0.33
241 0.35
242 0.32
243 0.25
244 0.23
245 0.19
246 0.18
247 0.17
248 0.15
249 0.14
250 0.11
251 0.11
252 0.12
253 0.1
254 0.09
255 0.09
256 0.08
257 0.08
258 0.09
259 0.09
260 0.09
261 0.08
262 0.07
263 0.07
264 0.08
265 0.08
266 0.07
267 0.07
268 0.08
269 0.11
270 0.11
271 0.11
272 0.12
273 0.16
274 0.17
275 0.22
276 0.26
277 0.28
278 0.31
279 0.32
280 0.3
281 0.26
282 0.27
283 0.27
284 0.26
285 0.23
286 0.21
287 0.22
288 0.22
289 0.24
290 0.24
291 0.2
292 0.19
293 0.21
294 0.21
295 0.21
296 0.25
297 0.28
298 0.26
299 0.27
300 0.29
301 0.33
302 0.37
303 0.34
304 0.3
305 0.25
306 0.25
307 0.22
308 0.18
309 0.14
310 0.09
311 0.09
312 0.09
313 0.09
314 0.09
315 0.08
316 0.08
317 0.07
318 0.07
319 0.07
320 0.07
321 0.07
322 0.07
323 0.07
324 0.07
325 0.07
326 0.06
327 0.05
328 0.05
329 0.05
330 0.05
331 0.04
332 0.04
333 0.04
334 0.04
335 0.04
336 0.04
337 0.04
338 0.04
339 0.04
340 0.05
341 0.05
342 0.05
343 0.05
344 0.05
345 0.05
346 0.07
347 0.06
348 0.08
349 0.08
350 0.08
351 0.09
352 0.08
353 0.08
354 0.07
355 0.07
356 0.06
357 0.06
358 0.06
359 0.05
360 0.07
361 0.07
362 0.07
363 0.07
364 0.07
365 0.1
366 0.11
367 0.12
368 0.11
369 0.12
370 0.12
371 0.11
372 0.13
373 0.1
374 0.11
375 0.1
376 0.11
377 0.13
378 0.14
379 0.14
380 0.13
381 0.13
382 0.12
383 0.12
384 0.12
385 0.11
386 0.1
387 0.1
388 0.1
389 0.1
390 0.09
391 0.09
392 0.08
393 0.07
394 0.07
395 0.07
396 0.07
397 0.07
398 0.07
399 0.06
400 0.06
401 0.05
402 0.07
403 0.07
404 0.06
405 0.06
406 0.06
407 0.06
408 0.05
409 0.06
410 0.04
411 0.05
412 0.06
413 0.06
414 0.06
415 0.06
416 0.08
417 0.1
418 0.11
419 0.11
420 0.11
421 0.12
422 0.15
423 0.17
424 0.16
425 0.19
426 0.21
427 0.25
428 0.34
429 0.34
430 0.34
431 0.36
432 0.41
433 0.42
434 0.41
435 0.42
436 0.37
437 0.39
438 0.38
439 0.39
440 0.37
441 0.38
442 0.44
443 0.46
444 0.5
445 0.48
446 0.5
447 0.5
448 0.49
449 0.45
450 0.39
451 0.37
452 0.3
453 0.33
454 0.33
455 0.3
456 0.34
457 0.35
458 0.32
459 0.28
460 0.32
461 0.35
462 0.4
463 0.47
464 0.49
465 0.53
466 0.55
467 0.6
468 0.58
469 0.53
470 0.48
471 0.45
472 0.46
473 0.44
474 0.46
475 0.42
476 0.38
477 0.39
478 0.38
479 0.32
480 0.24
481 0.2
482 0.15
483 0.16
484 0.16
485 0.14
486 0.17
487 0.18
488 0.18
489 0.17
490 0.17
491 0.14
492 0.14
493 0.14
494 0.11
495 0.1
496 0.1
497 0.12
498 0.13
499 0.14
500 0.13
501 0.13
502 0.12
503 0.11
504 0.11
505 0.08
506 0.06
507 0.05
508 0.05
509 0.05
510 0.07
511 0.08
512 0.15
513 0.16
514 0.18