Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3NCF9

Protein Details
Accession A0A0C3NCF9   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
49-70EVLVRRRKDWKESRKTKKPMILBasic
NLS Segment(s)
PositionSequence
53-66RRRKDWKESRKTKK
Subcellular Location(s) nucl 15, cyto 8, mito 2
Family & Domain DBs
Amino Acid Sequences MDSPYDADDGYDDWVLTDVEDGSNIIRQGTEQSVTGDGDQENFDINKLEVLVRRRKDWKESRKTKKPMILQSILGELHELDKNTELSHAEMQLKAGVWGCSSEWVFED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.09
5 0.07
6 0.06
7 0.06
8 0.07
9 0.06
10 0.09
11 0.09
12 0.08
13 0.07
14 0.08
15 0.1
16 0.12
17 0.12
18 0.11
19 0.12
20 0.13
21 0.14
22 0.13
23 0.12
24 0.1
25 0.1
26 0.1
27 0.09
28 0.08
29 0.08
30 0.08
31 0.07
32 0.07
33 0.07
34 0.07
35 0.08
36 0.1
37 0.15
38 0.22
39 0.23
40 0.27
41 0.33
42 0.35
43 0.43
44 0.51
45 0.56
46 0.6
47 0.69
48 0.76
49 0.8
50 0.85
51 0.82
52 0.79
53 0.76
54 0.74
55 0.71
56 0.63
57 0.54
58 0.48
59 0.44
60 0.37
61 0.28
62 0.2
63 0.12
64 0.12
65 0.12
66 0.11
67 0.1
68 0.12
69 0.12
70 0.12
71 0.14
72 0.12
73 0.13
74 0.15
75 0.18
76 0.18
77 0.18
78 0.18
79 0.19
80 0.18
81 0.16
82 0.16
83 0.13
84 0.12
85 0.13
86 0.13
87 0.16
88 0.17