Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DS57

Protein Details
Accession E9DS57    Localization Confidence High Confidence Score 23.2
NoLS Segment(s)
PositionSequenceProtein Nature
25-44ASMESKKKSRARKDDEDRLLHydrophilic
86-107VDRAIERKRKKVSGREKKELDGBasic
NLS Segment(s)
PositionSequence
29-37SKKKSRARK
70-71KK
85-113QVDRAIERKRKKVSGREKKELDGLQRRER
Subcellular Location(s) nucl 24, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009292  RRP36  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0000469  P:cleavage involved in rRNA processing  
KEGG maw:MAC_00455  -  
Pfam View protein in Pfam  
PF06102  RRP36  
Amino Acid Sequences MADLRAQIKTTKDARARDELKRQLASMESKKKSRARKDDEDRLLAEHRSKEKELVAQGKTPFYLKKSEQKKRLLLNRYEKMTKGQVDRAIERKRKKVSGREKKELDGLQRRER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.56
3 0.58
4 0.59
5 0.64
6 0.63
7 0.63
8 0.59
9 0.54
10 0.45
11 0.44
12 0.44
13 0.43
14 0.45
15 0.43
16 0.45
17 0.53
18 0.58
19 0.64
20 0.66
21 0.68
22 0.67
23 0.73
24 0.79
25 0.82
26 0.8
27 0.73
28 0.63
29 0.55
30 0.48
31 0.38
32 0.32
33 0.26
34 0.25
35 0.25
36 0.25
37 0.24
38 0.24
39 0.26
40 0.27
41 0.28
42 0.26
43 0.26
44 0.26
45 0.25
46 0.24
47 0.22
48 0.19
49 0.15
50 0.19
51 0.18
52 0.26
53 0.36
54 0.45
55 0.52
56 0.58
57 0.63
58 0.66
59 0.71
60 0.71
61 0.7
62 0.71
63 0.69
64 0.67
65 0.63
66 0.55
67 0.51
68 0.48
69 0.45
70 0.39
71 0.38
72 0.37
73 0.4
74 0.44
75 0.48
76 0.52
77 0.55
78 0.58
79 0.62
80 0.64
81 0.68
82 0.72
83 0.74
84 0.76
85 0.79
86 0.82
87 0.84
88 0.8
89 0.75
90 0.74
91 0.69
92 0.67
93 0.66