Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3JJX7

Protein Details
Accession A0A0C3JJX7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-67KGGPKTPKSCKEKWKRVRDTYMVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, mito 5, cyto 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR044822  Myb_DNA-bind_4  
Pfam View protein in Pfam  
PF13837  Myb_DNA-bind_4  
Amino Acid Sequences WSDKDTFALLDFIDSHKATAGDGLNFKAPFWNACAASPMLANPEKGGPKTPKSCKEKWKRVRDTYMVVDHLSHSSGFAYSLKSGADIGVANENSWDGYVKVHKDTAPYKNKGWLFYDRMSALIPSKCKGLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.15
4 0.15
5 0.13
6 0.17
7 0.17
8 0.16
9 0.17
10 0.18
11 0.21
12 0.21
13 0.21
14 0.2
15 0.19
16 0.16
17 0.18
18 0.22
19 0.18
20 0.18
21 0.21
22 0.18
23 0.18
24 0.17
25 0.14
26 0.14
27 0.14
28 0.14
29 0.12
30 0.15
31 0.17
32 0.17
33 0.23
34 0.23
35 0.28
36 0.37
37 0.44
38 0.5
39 0.55
40 0.62
41 0.66
42 0.73
43 0.77
44 0.79
45 0.82
46 0.82
47 0.82
48 0.82
49 0.75
50 0.68
51 0.61
52 0.54
53 0.44
54 0.34
55 0.27
56 0.21
57 0.18
58 0.14
59 0.09
60 0.07
61 0.06
62 0.06
63 0.06
64 0.06
65 0.07
66 0.07
67 0.08
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.06
74 0.06
75 0.11
76 0.11
77 0.1
78 0.1
79 0.1
80 0.09
81 0.09
82 0.09
83 0.05
84 0.08
85 0.12
86 0.14
87 0.17
88 0.19
89 0.2
90 0.25
91 0.31
92 0.39
93 0.44
94 0.46
95 0.46
96 0.52
97 0.54
98 0.51
99 0.49
100 0.47
101 0.44
102 0.42
103 0.45
104 0.37
105 0.36
106 0.33
107 0.31
108 0.28
109 0.27
110 0.27
111 0.23