Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3NC13

Protein Details
Accession A0A0C3NC13    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
73-100PEKGGPKTPKSCKEKWKRVCESVKQQNNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 14.166, mito 14, nucl 12, cyto_nucl 7.666
Family & Domain DBs
Amino Acid Sequences MPPRKAAKSSNHKGKSRSSQSLDGHSTQVSWSDKDMFALLDFINSHKATTGDSLNFKVPFWNACAASLMLANPEKGGPKTPKSCKEKWKRVCESVKQQNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.76
3 0.74
4 0.72
5 0.67
6 0.66
7 0.64
8 0.67
9 0.62
10 0.53
11 0.45
12 0.36
13 0.31
14 0.22
15 0.24
16 0.19
17 0.16
18 0.15
19 0.17
20 0.17
21 0.17
22 0.17
23 0.12
24 0.11
25 0.11
26 0.09
27 0.07
28 0.07
29 0.07
30 0.11
31 0.11
32 0.1
33 0.1
34 0.1
35 0.1
36 0.11
37 0.13
38 0.11
39 0.12
40 0.14
41 0.16
42 0.16
43 0.15
44 0.15
45 0.14
46 0.13
47 0.14
48 0.16
49 0.14
50 0.14
51 0.16
52 0.14
53 0.14
54 0.13
55 0.11
56 0.1
57 0.1
58 0.09
59 0.08
60 0.09
61 0.11
62 0.12
63 0.19
64 0.22
65 0.29
66 0.39
67 0.47
68 0.57
69 0.62
70 0.7
71 0.74
72 0.8
73 0.83
74 0.84
75 0.86
76 0.85
77 0.87
78 0.89
79 0.88
80 0.88