Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DXB9

Protein Details
Accession E9DXB9    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
326-358AKEPPQTFPKNGKPKKEKKLPPVGRTARKTRSQHydrophilic
NLS Segment(s)
PositionSequence
334-356PKNGKPKKEKKLPPVGRTARKTR
Subcellular Location(s) cyto 20.5, cyto_nucl 13.333, nucl 5, mito_nucl 3.333
Family & Domain DBs
KEGG maw:MAC_02267  -  
Amino Acid Sequences MTDTNVPAVEKVSGLGPDDAKPPVGAPPPERQPFLAVCPPAPAHKNEKDDAGLTDKPVDKPGEKLVQPAGENKINGGTGHGSTLPKPVEVMSVPETPVNGSTPAGGTPRPELTISEDPAPPAPEPPSEPIIEPVEMTGVEKPKPTPGTSVPDEKHTPSSSDVPAPREEPVQQSSVAKAPEPPMNDSPASGAMDVDKPEEKQPAPVTHTGPESEPVPAPAPAPAELPDAPPITTAEQPAPIPTAGPNDNAVGGKRKLDNVVPPVDGSSATAKPPTQDPAASDPLPLEKKPKLDKDAAANGQAAKAATASDPASNADPASEPAPAQTAKEPPQTFPKNGKPKKEKKLPPVGRTARKTRSQGPADA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.17
4 0.18
5 0.21
6 0.21
7 0.2
8 0.19
9 0.17
10 0.2
11 0.25
12 0.28
13 0.29
14 0.37
15 0.46
16 0.5
17 0.51
18 0.46
19 0.44
20 0.42
21 0.44
22 0.42
23 0.35
24 0.31
25 0.33
26 0.33
27 0.34
28 0.35
29 0.33
30 0.35
31 0.41
32 0.46
33 0.43
34 0.46
35 0.42
36 0.41
37 0.38
38 0.35
39 0.29
40 0.25
41 0.29
42 0.29
43 0.28
44 0.31
45 0.32
46 0.27
47 0.29
48 0.35
49 0.37
50 0.34
51 0.36
52 0.36
53 0.36
54 0.36
55 0.37
56 0.36
57 0.31
58 0.31
59 0.28
60 0.26
61 0.23
62 0.21
63 0.19
64 0.16
65 0.12
66 0.14
67 0.16
68 0.15
69 0.15
70 0.2
71 0.19
72 0.17
73 0.17
74 0.16
75 0.16
76 0.15
77 0.18
78 0.17
79 0.18
80 0.19
81 0.19
82 0.18
83 0.16
84 0.17
85 0.14
86 0.11
87 0.09
88 0.09
89 0.09
90 0.1
91 0.11
92 0.11
93 0.11
94 0.13
95 0.14
96 0.15
97 0.15
98 0.14
99 0.2
100 0.25
101 0.25
102 0.26
103 0.25
104 0.24
105 0.25
106 0.26
107 0.19
108 0.15
109 0.15
110 0.13
111 0.15
112 0.18
113 0.19
114 0.18
115 0.18
116 0.2
117 0.2
118 0.19
119 0.16
120 0.13
121 0.11
122 0.1
123 0.1
124 0.1
125 0.1
126 0.11
127 0.12
128 0.13
129 0.18
130 0.2
131 0.2
132 0.21
133 0.23
134 0.29
135 0.31
136 0.38
137 0.33
138 0.36
139 0.37
140 0.34
141 0.34
142 0.28
143 0.27
144 0.22
145 0.25
146 0.22
147 0.25
148 0.26
149 0.24
150 0.25
151 0.24
152 0.22
153 0.2
154 0.2
155 0.18
156 0.17
157 0.16
158 0.16
159 0.15
160 0.16
161 0.17
162 0.16
163 0.13
164 0.13
165 0.14
166 0.16
167 0.17
168 0.2
169 0.18
170 0.21
171 0.2
172 0.19
173 0.17
174 0.16
175 0.14
176 0.11
177 0.09
178 0.07
179 0.09
180 0.09
181 0.1
182 0.09
183 0.09
184 0.11
185 0.15
186 0.14
187 0.17
188 0.2
189 0.22
190 0.25
191 0.28
192 0.28
193 0.27
194 0.28
195 0.24
196 0.21
197 0.19
198 0.15
199 0.13
200 0.12
201 0.11
202 0.11
203 0.11
204 0.11
205 0.11
206 0.11
207 0.1
208 0.11
209 0.11
210 0.13
211 0.13
212 0.14
213 0.15
214 0.14
215 0.14
216 0.13
217 0.14
218 0.13
219 0.14
220 0.14
221 0.12
222 0.13
223 0.13
224 0.13
225 0.14
226 0.11
227 0.1
228 0.1
229 0.14
230 0.13
231 0.14
232 0.15
233 0.13
234 0.15
235 0.15
236 0.15
237 0.17
238 0.16
239 0.19
240 0.19
241 0.2
242 0.21
243 0.24
244 0.29
245 0.28
246 0.3
247 0.27
248 0.26
249 0.25
250 0.23
251 0.2
252 0.16
253 0.15
254 0.13
255 0.13
256 0.15
257 0.15
258 0.16
259 0.18
260 0.2
261 0.18
262 0.18
263 0.21
264 0.25
265 0.31
266 0.29
267 0.27
268 0.24
269 0.28
270 0.3
271 0.27
272 0.27
273 0.25
274 0.32
275 0.4
276 0.47
277 0.47
278 0.5
279 0.53
280 0.56
281 0.62
282 0.57
283 0.51
284 0.45
285 0.39
286 0.34
287 0.31
288 0.22
289 0.13
290 0.1
291 0.09
292 0.08
293 0.1
294 0.1
295 0.1
296 0.11
297 0.12
298 0.14
299 0.14
300 0.14
301 0.12
302 0.12
303 0.13
304 0.13
305 0.13
306 0.11
307 0.11
308 0.15
309 0.14
310 0.16
311 0.18
312 0.23
313 0.28
314 0.37
315 0.38
316 0.38
317 0.48
318 0.52
319 0.54
320 0.57
321 0.62
322 0.64
323 0.7
324 0.78
325 0.78
326 0.82
327 0.88
328 0.89
329 0.89
330 0.88
331 0.92
332 0.91
333 0.87
334 0.88
335 0.87
336 0.86
337 0.84
338 0.84
339 0.81
340 0.79
341 0.79
342 0.76
343 0.77