Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3P9R8

Protein Details
Accession A0A0C3P9R8    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
29-57CLNCLQRMIRLKKRTKRQRSGGKNGKGYEHydrophilic
NLS Segment(s)
PositionSequence
38-53RLKKRTKRQRSGGKNG
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MLHSREAPGDPQSDCCVTSMTSSSRLCTCLNCLQRMIRLKKRTKRQRSGGKNGKGYEDNISREHVMFSALAVYTSQRQNGRGCLLQYRRWTTCVTNHPPAIADALADTTGAAFSHAILRAETLTSKVIHVIVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.2
4 0.17
5 0.18
6 0.19
7 0.17
8 0.23
9 0.23
10 0.24
11 0.24
12 0.26
13 0.25
14 0.22
15 0.26
16 0.28
17 0.32
18 0.32
19 0.34
20 0.33
21 0.39
22 0.47
23 0.5
24 0.5
25 0.55
26 0.63
27 0.69
28 0.78
29 0.83
30 0.84
31 0.86
32 0.87
33 0.88
34 0.88
35 0.9
36 0.89
37 0.86
38 0.81
39 0.71
40 0.65
41 0.55
42 0.46
43 0.41
44 0.35
45 0.3
46 0.25
47 0.25
48 0.22
49 0.21
50 0.2
51 0.14
52 0.11
53 0.08
54 0.07
55 0.06
56 0.05
57 0.05
58 0.05
59 0.06
60 0.08
61 0.09
62 0.13
63 0.13
64 0.15
65 0.17
66 0.19
67 0.22
68 0.21
69 0.21
70 0.26
71 0.29
72 0.33
73 0.38
74 0.41
75 0.4
76 0.39
77 0.41
78 0.36
79 0.4
80 0.43
81 0.44
82 0.45
83 0.44
84 0.42
85 0.4
86 0.38
87 0.32
88 0.22
89 0.15
90 0.08
91 0.09
92 0.08
93 0.07
94 0.06
95 0.04
96 0.05
97 0.05
98 0.05
99 0.04
100 0.05
101 0.09
102 0.11
103 0.12
104 0.12
105 0.13
106 0.13
107 0.15
108 0.15
109 0.13
110 0.14
111 0.14
112 0.14
113 0.15