Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3KXH9

Protein Details
Accession A0A0C3KXH9   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
70-95HRTMPRGPMFPRRRRRRNRRMRTEESBasic
NLS Segment(s)
PositionSequence
78-91MFPRRRRRRNRRMR
Subcellular Location(s) nucl 11, mito 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
Amino Acid Sequences PNPSKRDLIRAYTLQHAESGLGNDYAKRKNVIRVRLEGEQFLLQAPDVPSVVEWIEGLHAGTNIALDLDHRTMPRGPMFPRRRRRRNRRMRTEES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.34
3 0.28
4 0.22
5 0.19
6 0.18
7 0.12
8 0.12
9 0.11
10 0.13
11 0.17
12 0.19
13 0.2
14 0.21
15 0.22
16 0.3
17 0.36
18 0.42
19 0.43
20 0.44
21 0.47
22 0.49
23 0.48
24 0.39
25 0.34
26 0.26
27 0.21
28 0.17
29 0.12
30 0.07
31 0.08
32 0.09
33 0.07
34 0.07
35 0.07
36 0.06
37 0.07
38 0.07
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.05
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.03
51 0.03
52 0.03
53 0.04
54 0.06
55 0.08
56 0.1
57 0.1
58 0.13
59 0.14
60 0.18
61 0.21
62 0.24
63 0.26
64 0.36
65 0.46
66 0.54
67 0.64
68 0.72
69 0.79
70 0.85
71 0.93
72 0.93
73 0.95
74 0.96
75 0.96