Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3PZ04

Protein Details
Accession A0A0C3PZ04    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
27-47QAPKWFQNKGKGKKKERDAYMHydrophilic
NLS Segment(s)
PositionSequence
28-42APKWFQNKGKGKKKE
Subcellular Location(s) mito 13, nucl 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences KSTCENCGKKGHTKDQCWEEGGRKAGQAPKWFQNKGKGKKKERDAYMNNYNHVLLAGESLNSTEETILFDSGASHHMSSYCSKFLNYKPIIPKPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.71
3 0.68
4 0.62
5 0.56
6 0.5
7 0.46
8 0.43
9 0.36
10 0.29
11 0.3
12 0.32
13 0.34
14 0.35
15 0.34
16 0.39
17 0.45
18 0.48
19 0.47
20 0.52
21 0.58
22 0.62
23 0.68
24 0.7
25 0.71
26 0.77
27 0.83
28 0.81
29 0.76
30 0.75
31 0.7
32 0.68
33 0.68
34 0.62
35 0.53
36 0.45
37 0.39
38 0.29
39 0.24
40 0.17
41 0.07
42 0.06
43 0.06
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.06
50 0.05
51 0.05
52 0.07
53 0.08
54 0.08
55 0.07
56 0.07
57 0.07
58 0.07
59 0.09
60 0.09
61 0.08
62 0.08
63 0.09
64 0.12
65 0.16
66 0.19
67 0.2
68 0.19
69 0.21
70 0.26
71 0.3
72 0.38
73 0.37
74 0.42
75 0.48