Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3PS74

Protein Details
Accession A0A0C3PS74    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
49-68KGGPKTPKSCKEKWKRLQSTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7.5, extr 7, cyto_mito 6, nucl 4, pero 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044822  Myb_DNA-bind_4  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF13837  Myb_DNA-bind_4  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
Amino Acid Sequences MQVSWSDKDMFALLDFINSHKATAGDSLNFKVPFWNAHAASLMLANPEKGGPKTPKSCKEKWKRLQSTYMVIDHLSHSSGFVYSPKSGADISVANENSWDGYMKVHKDTAPYKNKGWLFYDRMSVLIPSKCKGLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.17
5 0.16
6 0.16
7 0.14
8 0.15
9 0.14
10 0.17
11 0.18
12 0.16
13 0.18
14 0.19
15 0.24
16 0.24
17 0.23
18 0.22
19 0.2
20 0.19
21 0.21
22 0.27
23 0.21
24 0.22
25 0.23
26 0.2
27 0.2
28 0.18
29 0.14
30 0.08
31 0.08
32 0.07
33 0.07
34 0.07
35 0.09
36 0.09
37 0.15
38 0.18
39 0.24
40 0.33
41 0.4
42 0.49
43 0.54
44 0.61
45 0.66
46 0.72
47 0.77
48 0.78
49 0.81
50 0.8
51 0.76
52 0.76
53 0.68
54 0.63
55 0.54
56 0.45
57 0.35
58 0.27
59 0.24
60 0.17
61 0.15
62 0.1
63 0.07
64 0.07
65 0.06
66 0.06
67 0.06
68 0.07
69 0.09
70 0.09
71 0.09
72 0.09
73 0.1
74 0.1
75 0.1
76 0.1
77 0.09
78 0.1
79 0.15
80 0.15
81 0.14
82 0.14
83 0.14
84 0.13
85 0.12
86 0.11
87 0.06
88 0.08
89 0.13
90 0.15
91 0.17
92 0.19
93 0.2
94 0.25
95 0.31
96 0.39
97 0.44
98 0.46
99 0.46
100 0.52
101 0.54
102 0.52
103 0.5
104 0.47
105 0.44
106 0.42
107 0.46
108 0.38
109 0.36
110 0.34
111 0.31
112 0.28
113 0.27
114 0.28
115 0.23