Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9E7M8

Protein Details
Accession E9E7M8    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
94-122VLEARDAPEQRRRRRRRAHLVRGPGQRLABasic
NLS Segment(s)
PositionSequence
103-117QRRRRRRRAHLVRGP
Subcellular Location(s) mito 16, cyto 4.5, cyto_nucl 4.5, nucl 3.5
Family & Domain DBs
KEGG maw:MAC_05876  -  
Amino Acid Sequences MPLAPKAAAVPLTHPRLVDSQQPRGPVKREARQVALVVGQNRAVIRGVAGEEVGAARRQPRAGRLVRERRVLQRKVGQAVVDLGRGYGHPLVAVLEARDAPEQRRRRRRRAHLVRGPGQRLAGQRERDEGCC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.3
4 0.32
5 0.36
6 0.35
7 0.39
8 0.4
9 0.46
10 0.47
11 0.49
12 0.5
13 0.5
14 0.53
15 0.51
16 0.57
17 0.56
18 0.56
19 0.54
20 0.51
21 0.42
22 0.37
23 0.32
24 0.25
25 0.21
26 0.18
27 0.16
28 0.15
29 0.15
30 0.11
31 0.08
32 0.07
33 0.07
34 0.07
35 0.06
36 0.06
37 0.05
38 0.05
39 0.05
40 0.06
41 0.05
42 0.05
43 0.06
44 0.08
45 0.1
46 0.11
47 0.14
48 0.21
49 0.24
50 0.31
51 0.4
52 0.48
53 0.51
54 0.55
55 0.54
56 0.56
57 0.61
58 0.56
59 0.52
60 0.49
61 0.48
62 0.45
63 0.44
64 0.35
65 0.26
66 0.27
67 0.22
68 0.16
69 0.13
70 0.1
71 0.09
72 0.09
73 0.1
74 0.08
75 0.07
76 0.06
77 0.06
78 0.07
79 0.07
80 0.08
81 0.06
82 0.07
83 0.07
84 0.08
85 0.1
86 0.11
87 0.14
88 0.23
89 0.32
90 0.42
91 0.53
92 0.61
93 0.7
94 0.8
95 0.88
96 0.9
97 0.92
98 0.93
99 0.91
100 0.92
101 0.9
102 0.88
103 0.8
104 0.71
105 0.61
106 0.54
107 0.49
108 0.47
109 0.46
110 0.42
111 0.41
112 0.46