Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3IK25

Protein Details
Accession A0A0C3IK25   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
90-109SCPLQKKHYNKPCSIRHERTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto 7.5, cyto_nucl 7.5, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006692  Coatomer_WD-assoc_reg  
Gene Ontology GO:0030117  C:membrane coat  
GO:0005198  F:structural molecule activity  
GO:0006886  P:intracellular protein transport  
GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF04053  Coatomer_WDAD  
Amino Acid Sequences MCVLFLLADPRCSPLYILGYVPVHNRVYLADKDMNIYAYTLSLNVVEYQTAVLRGDMDSAAEILPSIPKEQLNKVARFLEARGMFLLSSSCPLQKKHYNKPCSIRHERTCALNIHRPRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.21
4 0.2
5 0.21
6 0.21
7 0.22
8 0.24
9 0.23
10 0.2
11 0.18
12 0.18
13 0.15
14 0.19
15 0.19
16 0.22
17 0.21
18 0.2
19 0.22
20 0.22
21 0.22
22 0.17
23 0.16
24 0.11
25 0.08
26 0.08
27 0.06
28 0.06
29 0.05
30 0.06
31 0.06
32 0.06
33 0.05
34 0.05
35 0.06
36 0.06
37 0.06
38 0.06
39 0.05
40 0.05
41 0.05
42 0.06
43 0.05
44 0.05
45 0.04
46 0.05
47 0.04
48 0.04
49 0.04
50 0.03
51 0.04
52 0.05
53 0.06
54 0.06
55 0.08
56 0.1
57 0.13
58 0.22
59 0.28
60 0.29
61 0.31
62 0.31
63 0.3
64 0.29
65 0.28
66 0.26
67 0.2
68 0.2
69 0.18
70 0.17
71 0.16
72 0.15
73 0.15
74 0.07
75 0.09
76 0.09
77 0.12
78 0.14
79 0.17
80 0.24
81 0.33
82 0.41
83 0.5
84 0.59
85 0.64
86 0.7
87 0.77
88 0.79
89 0.79
90 0.81
91 0.8
92 0.77
93 0.78
94 0.73
95 0.69
96 0.64
97 0.61
98 0.58
99 0.58