Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9DV48

Protein Details
Accession E9DV48   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
370-391FGTSKPVKSGERKKAKASKKNRBasic
NLS Segment(s)
PositionSequence
375-391PVKSGERKKAKASKKNR
Subcellular Location(s) plas 18, E.R. 4, golg 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007873  Glycosyltransferase_ALG3  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0052925  F:dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase activity  
GO:0006486  P:protein glycosylation  
KEGG maw:MAC_01438  -  
Pfam View protein in Pfam  
PF05208  ALG3  
Amino Acid Sequences MAPHEPPLKQALRFALDVANGRHALSKLIPLVLWLADAVLCGLVIWKVPYTEIDWVAYMEQVAQFVAGERDYTKIEGGTGPLVYPAAHVYVYTGLYYLTDRGKNVLLAQQIFAVLYMATLAVVMLCYWKAKRRQWTMGSIAYSWGLGIKMSLLLSLPAVGIVLFLGRGFGGSLRLAWLMAQMQLVIALPFLAKNWQGYLGRAFELSRQFKFEWTVNWRMMGEELFVSKQFAMVLLVLHAVVLLIFVTSRWLQPADRSLVSLISPMLRGRSPFTPAEELGVSSRVTPDYIMTTILSANVVGFLFARSLHYQFYVYLAWATPYLLWKAWPYTPVVCLLWAVQEAAWNTFPSTDLSSTTVVNVLLITVVLVYFGTSKPVKSGERKKAKASKKNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.32
3 0.3
4 0.33
5 0.3
6 0.3
7 0.26
8 0.26
9 0.28
10 0.25
11 0.25
12 0.22
13 0.25
14 0.21
15 0.22
16 0.21
17 0.18
18 0.2
19 0.17
20 0.15
21 0.1
22 0.08
23 0.07
24 0.07
25 0.07
26 0.05
27 0.04
28 0.04
29 0.05
30 0.05
31 0.06
32 0.07
33 0.08
34 0.08
35 0.09
36 0.11
37 0.13
38 0.18
39 0.18
40 0.18
41 0.18
42 0.18
43 0.18
44 0.16
45 0.13
46 0.1
47 0.09
48 0.08
49 0.07
50 0.06
51 0.06
52 0.07
53 0.08
54 0.07
55 0.08
56 0.08
57 0.1
58 0.11
59 0.12
60 0.12
61 0.11
62 0.12
63 0.12
64 0.13
65 0.12
66 0.11
67 0.1
68 0.1
69 0.1
70 0.09
71 0.09
72 0.08
73 0.07
74 0.07
75 0.07
76 0.08
77 0.09
78 0.1
79 0.09
80 0.09
81 0.07
82 0.08
83 0.09
84 0.11
85 0.13
86 0.14
87 0.15
88 0.17
89 0.18
90 0.18
91 0.19
92 0.2
93 0.19
94 0.19
95 0.19
96 0.17
97 0.16
98 0.15
99 0.13
100 0.09
101 0.05
102 0.04
103 0.04
104 0.03
105 0.03
106 0.03
107 0.03
108 0.02
109 0.03
110 0.03
111 0.03
112 0.04
113 0.06
114 0.07
115 0.14
116 0.23
117 0.29
118 0.39
119 0.47
120 0.55
121 0.58
122 0.64
123 0.62
124 0.59
125 0.54
126 0.44
127 0.37
128 0.28
129 0.23
130 0.16
131 0.11
132 0.07
133 0.05
134 0.05
135 0.04
136 0.05
137 0.05
138 0.05
139 0.04
140 0.05
141 0.05
142 0.05
143 0.05
144 0.04
145 0.04
146 0.03
147 0.03
148 0.03
149 0.03
150 0.02
151 0.02
152 0.03
153 0.02
154 0.03
155 0.03
156 0.03
157 0.05
158 0.05
159 0.05
160 0.06
161 0.06
162 0.06
163 0.06
164 0.06
165 0.06
166 0.06
167 0.06
168 0.05
169 0.05
170 0.05
171 0.05
172 0.04
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.05
179 0.05
180 0.05
181 0.06
182 0.1
183 0.1
184 0.11
185 0.13
186 0.13
187 0.13
188 0.13
189 0.13
190 0.13
191 0.2
192 0.22
193 0.2
194 0.23
195 0.23
196 0.23
197 0.26
198 0.24
199 0.22
200 0.25
201 0.3
202 0.26
203 0.27
204 0.26
205 0.23
206 0.23
207 0.17
208 0.12
209 0.07
210 0.08
211 0.07
212 0.07
213 0.08
214 0.07
215 0.07
216 0.06
217 0.06
218 0.06
219 0.06
220 0.06
221 0.05
222 0.05
223 0.05
224 0.05
225 0.04
226 0.03
227 0.03
228 0.03
229 0.02
230 0.02
231 0.02
232 0.02
233 0.05
234 0.06
235 0.06
236 0.07
237 0.09
238 0.09
239 0.12
240 0.17
241 0.2
242 0.19
243 0.2
244 0.19
245 0.19
246 0.18
247 0.16
248 0.12
249 0.08
250 0.09
251 0.08
252 0.1
253 0.1
254 0.11
255 0.14
256 0.16
257 0.19
258 0.2
259 0.23
260 0.25
261 0.24
262 0.26
263 0.23
264 0.21
265 0.18
266 0.18
267 0.14
268 0.11
269 0.12
270 0.1
271 0.1
272 0.09
273 0.09
274 0.1
275 0.11
276 0.11
277 0.1
278 0.1
279 0.1
280 0.1
281 0.09
282 0.06
283 0.06
284 0.06
285 0.06
286 0.05
287 0.05
288 0.05
289 0.06
290 0.06
291 0.1
292 0.11
293 0.12
294 0.13
295 0.14
296 0.15
297 0.15
298 0.17
299 0.14
300 0.13
301 0.12
302 0.11
303 0.11
304 0.1
305 0.11
306 0.09
307 0.11
308 0.13
309 0.13
310 0.14
311 0.15
312 0.19
313 0.2
314 0.21
315 0.22
316 0.22
317 0.23
318 0.25
319 0.23
320 0.2
321 0.18
322 0.17
323 0.16
324 0.14
325 0.13
326 0.1
327 0.13
328 0.14
329 0.16
330 0.17
331 0.15
332 0.15
333 0.15
334 0.16
335 0.15
336 0.17
337 0.16
338 0.16
339 0.18
340 0.19
341 0.19
342 0.19
343 0.18
344 0.14
345 0.13
346 0.11
347 0.08
348 0.07
349 0.06
350 0.05
351 0.04
352 0.04
353 0.04
354 0.04
355 0.04
356 0.06
357 0.06
358 0.12
359 0.13
360 0.14
361 0.17
362 0.23
363 0.3
364 0.39
365 0.5
366 0.55
367 0.66
368 0.7
369 0.78
370 0.82
371 0.85