Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3INU8

Protein Details
Accession A0A0C3INU8    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
45-67KGGPKTPKSCKEKWKRVRDTYAVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 9, cyto 7.5, mito 7, cyto_nucl 6, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR044822  Myb_DNA-bind_4  
Pfam View protein in Pfam  
PF13837  Myb_DNA-bind_4  
Amino Acid Sequences WSDKDTFALLDFIDSHKATAGDGLNFKAPFWNACAASPMLANLEKGGPKTPKSCKEKWKRVRDTYAVIDHLSRSSGFAYSLKSGADIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.14
5 0.13
6 0.16
7 0.16
8 0.14
9 0.15
10 0.16
11 0.19
12 0.19
13 0.19
14 0.17
15 0.16
16 0.14
17 0.15
18 0.19
19 0.15
20 0.15
21 0.18
22 0.15
23 0.15
24 0.14
25 0.12
26 0.09
27 0.09
28 0.08
29 0.07
30 0.08
31 0.08
32 0.09
33 0.13
34 0.13
35 0.15
36 0.21
37 0.29
38 0.37
39 0.43
40 0.5
41 0.57
42 0.66
43 0.75
44 0.79
45 0.83
46 0.83
47 0.85
48 0.86
49 0.8
50 0.75
51 0.7
52 0.64
53 0.54
54 0.45
55 0.37
56 0.3
57 0.26
58 0.21
59 0.15
60 0.11
61 0.11
62 0.11
63 0.12
64 0.12
65 0.16
66 0.17
67 0.18
68 0.17