Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3JEI9

Protein Details
Accession A0A0C3JEI9   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MATTKTRRTKKRSPPSVKFVDPSHydrophilic
87-106ESRAKSRKPEPGKLKRLWLRBasic
NLS Segment(s)
PositionSequence
63-65RKP
89-102RAKSRKPEPGKLKR
Subcellular Location(s) nucl 16.5, mito_nucl 13.166, cyto_nucl 10.333, mito 8.5
Family & Domain DBs
Amino Acid Sequences MATTKTRRTKKRSPPSVKFVDPSTGHNDDSRLSSPPCSPPLAAPSSSRRKLTPAEWFMKWWRRKPNPPPRPTISGPYRLSQAASLAESRAKSRKPEPGKLKRLWLRVTNATG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.87
4 0.8
5 0.72
6 0.63
7 0.59
8 0.5
9 0.44
10 0.42
11 0.37
12 0.34
13 0.32
14 0.3
15 0.24
16 0.26
17 0.24
18 0.2
19 0.18
20 0.19
21 0.21
22 0.24
23 0.26
24 0.24
25 0.23
26 0.21
27 0.25
28 0.25
29 0.24
30 0.23
31 0.28
32 0.35
33 0.38
34 0.38
35 0.33
36 0.33
37 0.35
38 0.36
39 0.38
40 0.35
41 0.36
42 0.35
43 0.36
44 0.39
45 0.45
46 0.46
47 0.43
48 0.47
49 0.52
50 0.61
51 0.7
52 0.76
53 0.78
54 0.78
55 0.79
56 0.74
57 0.73
58 0.66
59 0.63
60 0.57
61 0.55
62 0.52
63 0.46
64 0.42
65 0.35
66 0.34
67 0.25
68 0.22
69 0.14
70 0.13
71 0.13
72 0.12
73 0.14
74 0.14
75 0.17
76 0.22
77 0.23
78 0.27
79 0.33
80 0.42
81 0.48
82 0.58
83 0.65
84 0.7
85 0.77
86 0.77
87 0.81
88 0.79
89 0.78
90 0.75
91 0.71
92 0.67