Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3K1B2

Protein Details
Accession A0A0C3K1B2    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
30-60HEYGKWSFLRKKKKKKQHQRKDYKNYMEVPRBasic
NLS Segment(s)
PositionSequence
39-50RKKKKKKQHQRK
Subcellular Location(s) mito 18, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MRVLRVTSEHARSNHFLDGYLLVLTPYHLHEYGKWSFLRKKKKKKQHQRKDYKNYMEVPRTWRSELTLTVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.33
3 0.28
4 0.23
5 0.22
6 0.17
7 0.15
8 0.11
9 0.08
10 0.07
11 0.07
12 0.07
13 0.07
14 0.09
15 0.09
16 0.09
17 0.1
18 0.16
19 0.17
20 0.19
21 0.19
22 0.2
23 0.26
24 0.33
25 0.44
26 0.49
27 0.59
28 0.66
29 0.77
30 0.85
31 0.9
32 0.94
33 0.94
34 0.95
35 0.95
36 0.96
37 0.96
38 0.94
39 0.9
40 0.85
41 0.8
42 0.77
43 0.71
44 0.64
45 0.6
46 0.57
47 0.53
48 0.5
49 0.43
50 0.39
51 0.37